SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006220 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006220
Domain Number 1 Region: 243-347
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-30
Family Pleckstrin-homology domain (PH domain) 0.00000356
Further Details:      
 
Domain Number 2 Region: 116-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-27
Family DEP domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 4-102
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-25
Family Pleckstrin-homology domain (PH domain) 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006220   Gene: ENSMPUG00000006274   Transcript: ENSMPUT00000006329
Sequence length 350
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:10711752:10737683:1 gene:ENSMPUG00000006274 transcript:ENSMPUT00000006329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKRIREGYLVKRGSMFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETVDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNNSVRNRQEGLMI
ASSLLGEGYLQPAGELSKNAADGISENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAIHLRGCVVTSV
ESSSDVRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQVASRTGK
Download sequence
Identical sequences M3Y4G9
XP_004742150.1.14098 ENSMPUP00000006220 ENSMPUP00000006220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]