SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006297 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006297
Domain Number 1 Region: 51-174
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.79e-21
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 2 Region: 222-271
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000357
Family CUE domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006297   Gene: ENSMPUG00000006351   Transcript: ENSMPUT00000006406
Sequence length 274
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:9060924:9069541:1 gene:ENSMPUG00000006351 transcript:ENSMPUT00000006406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPTDGVLSPKVYVGELPQDFLRITPTAAQQQVQLDAQAAQQLQYGGAAGTVGRLSITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHVTIPESLKQGKVEDEWYSLSGRQGDDKEGMINLVMSYASLPATVM
MPPQPVVLMPTVYQQGVGYVPITGVPAVCSPGVVPVALPPAAVSAPARCSEEDLRAIQDM
FPNMDREVIRSVLEAQRGDRDAAINSLLQMGEES
Download sequence
Identical sequences M3Y4P6
ENSMPUP00000006297 ENSMPUP00000006297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]