SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006337 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006337
Domain Number 1 Region: 23-595
Classification Level Classification E-value
Superfamily ARM repeat 4.22e-99
Family Clathrin adaptor core protein 0.00000106
Further Details:      
 
Domain Number 2 Region: 617-632,659-781
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 2.96e-38
Family gamma-adaptin C-terminal appendage domain-like 0.0000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006337   Gene: ENSMPUG00000006392   Transcript: ENSMPUT00000006447
Sequence length 783
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:6974751:6986600:1 gene:ENSMPUG00000006392 transcript:ENSMPUT00000006447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPLHRHRQLAKLLYVHML
GYPAHFGQMECLKLITSPRFTDKRVGYLGAMLLLDERQDAHLLITNSIKNDLSQGIQAVQ
GLALCTLSTVGSAEMCRDLATEVEKLLLQPGPYVRKKAVLTAVHIIRKVPELSNIFLPPC
AQLLHERHHGVLLGTITLITELCERSPAALKHFRKVVPQLVQILWTLVTTGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
RSVAGLRVLAVNILGRFLLNSDKNIRYVALTSLLRVVQSDHSAVQRHRPTVVECLREPDA
SLSRRALELSLALVNSSNVRAMTQELQSFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILRVLTMAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYSALAEDISQQPLVQVAAWC
IGEYGDLLLEGSCEETEPLQVEEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLRG
DNNRIRQVVSVYGSCLDVELQQRAVEYNALFQKYDHMRAAILEKMPLVERGGTQDEEAKE
SKEAQHSEAALVPTEPQASKLLDLLDLLDGTSGAAQPPPPLEPSSEGTSVHLLDLPCVSS
APASIPNLKVFEREGLQLNLSFVRPPGTPALLLIMVTAINTSEADVTHFVCQAAVPKSFQ
LQLQAPSGDTVPAQGGLPVTQLLRILNPKKAPLRLKLRLTYNHFGQSVQEIFEVNNLPVE
TWQ
Download sequence
Identical sequences M3Y4T6
XP_004755342.1.14098 ENSMPUP00000006337 ENSMPUP00000006337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]