SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006338 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006338
Domain Number 1 Region: 338-701
Classification Level Classification E-value
Superfamily SIS domain 3.9e-104
Family double-SIS domain 0.00000042
Further Details:      
 
Domain Number 2 Region: 3-214,269-313
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.61e-48
Family Class II glutamine amidotransferases 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006338   Gene: ENSMPUG00000006393   Transcript: ENSMPUT00000006448
Sequence length 701
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:11456042:11497532:-1 gene:ENSMPUG00000006393 transcript:ENSMPUT00000006448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTSNRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFT
RWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDD
VAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTM
RGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVEL
ASDFLDRNTPVFRDDVCFFISQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDC
GVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEV
LSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPL
ALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTNRTIKVPHS
VDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences M3Y4T7
ENSMPUP00000006338 ENSMPUP00000006338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]