SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006340 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006340
Domain Number 1 Region: 471-779
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.01e-103
Family PDEase 0.000000583
Further Details:      
 
Domain Number 2 Region: 257-448
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-48
Family GAF domain 0.0000316
Further Details:      
 
Domain Number 3 Region: 100-249
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-20
Family GAF domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006340   Gene: ENSMPUG00000006396   Transcript: ENSMPUT00000006451
Sequence length 794
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897047.1:2305247:2587267:-1 gene:ENSMPUG00000006396 transcript:ENSMPUT00000006451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKPEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKAD
GFALYFLGECNNSLCVFTPPGIKEGQPRLIPAGPIAQGTTTSAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGVLELYRHWGKEAFCMSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQDLMRFSLPVRLCKEIELFHFDIG
PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNHGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKD
EVPQGQLGFYNAVAIPCYTTLTQIFPPTEPLLKACRNNLSQWEKVIRGEESAVWASSRPA
APGPSEKLPVKVDD
Download sequence
Identical sequences M3Y4T9
ENSMPUP00000006340 ENSMPUP00000006340 XP_004769632.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]