SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006347 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006347
Domain Number 1 Region: 380-441
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000677
Family Myb/SANT domain 0.0091
Further Details:      
 
Domain Number 2 Region: 505-565
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000185
Family Erythroid transcription factor GATA-1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006347   Gene: ENSMPUG00000006403   Transcript: ENSMPUT00000006458
Sequence length 1553
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:804317:1228865:1 gene:ENSMPUG00000006403 transcript:ENSMPUT00000006458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKDKDKDKEKDRDRDRDRERDKRDKAREGENSRPRRSCTLEGGAKNYAESDHSEDED
NDNNSATTEESTKKNKKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNT
PYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
LMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAA
LRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPELQ
PFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK
ELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVSTPSRPPSS
EFRPVDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKK
YGELPPIEKPVDPPPFMFKPVKEEEDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGR
ASPINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEASSPLKSSKRQREKAASDT
EEADRTSSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSP
QDNESDSDSSAQQQMLQAQPPALQGAPSAAPPVPSTVPPGAPQLPTPGPTPSATAGPPQG
SPSASQPPSQPQAPVASAPHAHIQQAPALHPQRLPSPHPPLQPLTVTAGQTSAPPHSQPP
LHSQGPGGPHSLQAGPLLQHPGPPQPFGLPPQASQASALPHASLQPTASQSALQPQQPPR
EQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSMNANLPPPPALKPLSS
LSTHHPPSAHPPPLQLMPQSQPLPSSPAQPPVLTQSQSLPPAAATHPPAGLHQVPPQPPF
AQHPFVPGGPPSITPPTCSSTATPPAGPGPSAQPPCSAAVSSGGSGPGGAACPLPTVQIK
EEALDDAEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRGYNSCARTDLYFMPL
AGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKEREREREREREAERSAQKASSSAH
EGRLSDPQLSGPGHLRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYARPHVMSPTNRNHP
FYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELRERMKPGFEVKPPE
LDPLHPATNPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLALAGPQLRPEMSYP
DRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGPVH
PLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYPRDLPGAIPPPMSA
AHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKKEGDKQL
Download sequence
Identical sequences M3Y4U6
ENSMPUP00000006347 ENSMPUP00000006347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]