SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006356 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006356
Domain Number 1 Region: 122-193
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-19
Family Homeodomain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006356   Gene: ENSMPUG00000006412   Transcript: ENSMPUT00000006467
Sequence length 284
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:14094888:14097781:-1 gene:ENSMPUG00000006412 transcript:ENSMPUT00000006467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHSLQAHQHQLQDSLLGPLTSSLVDLGS
Download sequence
Identical sequences M3Y4V5
ENSMPUP00000006356 ENSMPUP00000006356 XP_004738936.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]