SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006358 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006358
Domain Number 1 Region: 136-209
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.21e-26
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.0000105
Further Details:      
 
Domain Number 2 Region: 100-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000114
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006358   Gene: ENSMPUG00000006414   Transcript: ENSMPUT00000006469
Sequence length 275
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:4221099:4246441:-1 gene:ENSMPUG00000006414 transcript:ENSMPUT00000006469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGDASREPAASEPPAELPASVGASMERKRQRALMLRQARLAARPYPATAAAAAATGG
VANVKAAPRIIDTGGGFILEEEEEEQRTTGKVVHQPGPVMEFDYAICEECGKEFMDSYLM
THFDLATCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALKCIVKKNPHHSQWGDM
KLYLKLQIVKRSLEVWGSQEALEEAKEARQENREKMKQKKFDKKVKELRRAIRSSVWKRE
TVAHQHEYGPEENLEEDMYRKTCTVCGHELTYEKM
Download sequence
Identical sequences M3Y4V7
XP_004747721.1.14098 ENSMPUP00000006358 ENSMPUP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]