SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006359 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006359
Domain Number 1 Region: 239-580
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.79e-131
Family Mammalian PLC 0.00000000116
Further Details:      
 
Domain Number 2 Region: 819-882,923-1066
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.57e-65
Family C-terminal domain of PLC-beta 0.0000791
Further Details:      
 
Domain Number 3 Region: 70-237
Classification Level Classification E-value
Superfamily EF-hand 1.63e-53
Family EF-hand modules in multidomain proteins 0.00000646
Further Details:      
 
Domain Number 4 Region: 600-718
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.02e-25
Family PLC-like (P variant) 0.0000707
Further Details:      
 
Domain Number 5 Region: 5-68
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000016
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006359   Gene: ENSMPUG00000006415   Transcript: ENSMPUT00000006470
Sequence length 1096
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896928.1:3012169:3252593:1 gene:ENSMPUG00000006415 transcript:ENSMPUT00000006470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIIQDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSL
ATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSS
RNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPR
LNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNED
MSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVIT
HGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALL
MEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSMF
EPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEI
SKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNA
GCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANT
LSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKV
VLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLMLPAVFVYIEVKD
YVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEAPSEART
TPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPVKTEDLIQSVLTEVEAQTIEELKQQK
SFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKTAKKDSKKK
SDPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKL
LIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTE
MIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKGDDSSSFLSETCHEDP
SVSPNFTPPNPQALKW
Download sequence
Identical sequences M3Y4V8
ENSMPUP00000006359 ENSMPUP00000006359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]