SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006362 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006362
Domain Number 1 Region: 28-182
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.1e-66
Family T-box 0.0000000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006362   Gene: ENSMPUG00000006418   Transcript: ENSMPUT00000006473
Sequence length 395
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897047.1:2980079:2989178:-1 gene:ENSMPUG00000006418 transcript:ENSMPUT00000006473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSQASCLTSKGLKPQIRGRELPPFLCRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNH
RWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIML
NSLHKYEPRIHIVRVGGAQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDA
KERSDHKDTMEEPGDSQQSAYSQWGWLIPGTSSLCPPATPHPQFGGPLSLPSTHGCERYP
ALRNHRPTPYPSPYAHRNNSPTYSDNPSACLSMLQSHESWPSLGTPTHTGMLPMSHGTGP
PTSSSQYPSLWSVSNGAITPGAPTAAMANGLGAQFFRGSPAHAAPLTHPGQASSSSGSPL
YEGAPTATDIPDSQYDAAAQARLLASWTPVSPPSM
Download sequence
Identical sequences M3Y4W1
XP_004769634.1.14098 ENSMPUP00000006362 ENSMPUP00000006362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]