SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006388 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006388
Domain Number 1 Region: 14-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.56e-32
Family PB1 domain 0.00000602
Further Details:      
 
Domain Number 2 Region: 128-250
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-22
Family PDZ domain 0.00000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006388   Gene: ENSMPUG00000006443   Transcript: ENSMPUT00000006499
Sequence length 346
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:18554193:18555851:1 gene:ENSMPUG00000006443 transcript:ENSMPUT00000006499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPQRTPARSPDNIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALATGPPPLRLLVQKRAEADSSGLAFPSNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASARLTGPRSAGLGPTEADSDDDSSDLVIENRQPPCSNGLSQ
GPPCWDLRQGRLLPGARSSLPSLDDQEQASSGWGSSMRGDGSGFSL
Download sequence
Identical sequences M3Y4Y7
ENSMPUP00000006388 ENSMPUP00000006388 XP_004744484.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]