SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006404
Domain Number 1 Region: 93-149
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-23
Family Homeodomain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006404   Gene: ENSMPUG00000006459   Transcript: ENSMPUT00000006515
Sequence length 149
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896999.1:5797311:5799977:-1 gene:ENSMPUG00000006459 transcript:ENSMPUT00000006515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL
TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET
HYPDIYTREELALKIDLTEARVQVWFQNR
Download sequence
Identical sequences M3Y503
ENSMPUP00000006404 ENSMPUP00000006404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]