SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006409 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006409
Domain Number 1 Region: 616-779
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-44
Family Ypt/Rab-GAP domain of gyp1p 0.001
Further Details:      
 
Domain Number 2 Region: 759-874
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-25
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 3 Region: 49-149
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-19
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006409
Domain Number - Region: 366-421
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0353
Family BRCA2 tower domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006409   Gene: ENSMPUG00000006464   Transcript: ENSMPUT00000006520
Sequence length 930
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:4654153:4707792:-1 gene:ENSMPUG00000006464 transcript:ENSMPUT00000006520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAHENPAECSSSAPSSEEPAGSARGPEVLPREESEGCARPLDAAPKKLCGYLSKFGGK
GPIRGWKSRWFFYDEKKCHLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGTFEIKTPSR
VITLKAATKQVMLYWLQQLQTKRWEFHSSPPAPPAAPATPAANGPTLRLEPEQEEAELEE
FLCPVQTPPGLVGVEAALQPAPAMPLALQNISLKHLGTEIQNTMYNIRGNRQAQGIGHGP
PGEDPPGSVEPQRVEQPLPSDPGTPGKDPADSPKPTPKSSLTANLIQKAKRQNTTFPLFA
EGLTRTRTAQEKVLALEQQVLMLTKELKSQKELVRILHKALEAAQQEKRASSAYLAAAED
KDRLELVRHKVRQIAELSRQVEALEQERESLAHTASLREQQLQELQRHVQLLMEKNQAKQ
QVICKLSEQVTRDFMQPPSQTPVPPEVADRDFLSQQEKMEHLKDDMEAYRTQNRFLNSEI
HQVTKIWRRVAEKEKALLMKCAYLQAKNCQVESKYLAGLQRLQEAAEGECAELLRQLIQE
ALQCEAREALAEGVELSPVSEYDEYGFLTVPNYEMEDLKLLAKIQALEVHSHYLLAHEAV
ERPLRERWAALGDLAPSAELKQLLRAGVPREHRPRVWKWLIHLRVRHLQIPGRYQALLSQ
GQVRKHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRL
AAIALLVLEEEESAFWCLVAIVETIMPPDYYSKTLTSSQVDQRVLQDLLLEKLPRLMAHL
GQHRVDLSFLTFNWFLVVFSDSLISNILLRVWDAFLYEGTKVIFRYALAIFKYNEEEILR
LQDALEIYQYLRFFTKTICNSQKLMHIAFNDMNPFPMKQLQQLRTAHRERLEAELRELEQ
LKAEYLETRNSQGPAVPEGCTSEDEGEGEA
Download sequence
Identical sequences M3Y508
ENSMPUP00000006409 XP_004747736.1.14098 ENSMPUP00000006409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]