SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006445 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006445
Domain Number 1 Region: 352-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-94
Family Protein kinases, catalytic subunit 0.0000000117
Further Details:      
 
Domain Number 2 Region: 8-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.17e-25
Family PLC-like (P variant) 0.0000233
Further Details:      
 
Domain Number 3 Region: 234-298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.07e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00051
Further Details:      
 
Domain Number 4 Region: 159-224
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006445   Gene: ENSMPUG00000006500   Transcript: ENSMPUT00000006556
Sequence length 683
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:14659036:14883109:1 gene:ENSMPUG00000006500 transcript:ENSMPUT00000006556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGYQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCTNVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNMNKMDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGRENTKEGNGIGVNSSSRLGIDNFEFIRV
LGKGSFGKVMLARIKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTADRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQVEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSFVSPELQP
Download sequence
Identical sequences M3Y544
XP_004738943.1.14098 ENSMPUP00000006445 ENSMPUP00000006445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]