SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006530 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006530
Domain Number 1 Region: 206-306
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-28
Family Ras-binding domain, RBD 0.00000237
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-22
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 962-1061
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 365-461
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.57e-19
Family FHA domain 0.0000031
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006530
Domain Number - Region: 1332-1418
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006530   Gene: ENSMPUG00000006585   Transcript: ENSMPUT00000006642
Sequence length 1789
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897047.1:4070174:4170429:1 gene:ENSMPUG00000006585 transcript:ENSMPUT00000006642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEE
RRLDIDEKPLVVQLNWNKDDREGRFVLKNENDALPPKKAQSNGPEKQEKEGVIQNFKRTL
SKKEKKEKKKREKEAVRQASDKDDRPFQGDDTENSRLAAEVYKDMPETSFTRTISNPEVV
MKRRRQQKLERRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEA
LEKYGLERENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGVLVF
QLKRRPPDYIPKKTKKHVDGKLARGKEKAEGSGYGSALPPEKLPYLVELSPGRRNHFAYY
NYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDEDSIQLFGSGIQPHHCDLTNMDGVVTV
TPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHTLAKRSADGCLTAKA
PRQKPGIVQETAFDLGGDVHSGTALPTSKSATRLDGDRAVPASGSAERGMVKPMIRVEQQ
DCRRQESRTQDAPGPELVLPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMAC
RYVLSGQCRPDASPGERTHRVIAVVHKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANA
SELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQ
RPKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPESGLCSHYW
GAIIRQQLGHVEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSAEDIPTVNSTCFKLNS
LQLQALLQNYHCAPDEPFVPADLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLL
PEDGYSCDVVRNIPNGLQEFLDPLCQRGFCRLIPHARSPGTWTIYFEGADYESHLLREST
ELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAG
DQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISD
RRGSGKPRPKSEGFELYNNSAPNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPN
VANQPPSPGGKSAYTPGATAKITSVSTGNLCTEEQSPPPRPEAYPIPTQTYSREYFTFPA
SRSQDRVAAPQNQWPSYEEKPRTHTDSSHSSVAVQRVTRSQEELREDKAYQLERRRIEAA
LDRKSDSDMWIHQSPSVGSSTSSQEHLDHSSKSGTPASTLTKSGPGRWKTPATVQPMPVA
VSQPVQTDLPPPPPPPPTHYAGDLDGIPVDLPLPPPPTGQTGPAAAQAAAAERRKREEHQ
RWYEKEKARLEEERDRKRREQERKLGQMRSQSLNPAPFSPGTVPHVKPEKPSTLQRPQET
VIRELQPQQQPRTIERRDLQYVTVSREELSSGDSLSPDPWKRDAREKLEKQQQMHIVDML
SREIQELQSRPERSAEESDRLRKLMLEWQFQKRLQESKQKDEEDEDEEDDDVDTMLIMQR
LEAERRARLQDEERRRQQQLEEMRKREAEDRARQEDERRRQEEERTKRDAEEKRRQEEGY
YSRLEAERRRQHAEAERRLLEPEEPGLCRPPLPRGYELPSPSPPAAAPPPPPQRTASSLQ
APALSPDSLYTARLVSYHEEEEEEEPCSLAGPNSYMGSAGTAVGAHDAYRDPRERPSKSH
EADLPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNTK
Download sequence
Identical sequences M3Y5C9
ENSMPUP00000006530 ENSMPUP00000006530 XP_012899792.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]