SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006570 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006570
Domain Number 1 Region: 21-144,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-74
Family Calponin-homology domain, CH-domain 0.0000404
Further Details:      
 
Domain Number 2 Region: 6177-6332
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 5957-6083
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-16
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 4 Region: 4895-5036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000314
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 6086-6195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000149
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 6627-6773
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000456
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 7 Region: 6529-6664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000104
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 8 Region: 5118-5250
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000113
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 9 Region: 5743-5899
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000232
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 5577-5690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000641
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 11 Region: 3730-3877
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000072
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 12 Region: 3304-3462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000011
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 13 Region: 2219-2342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000245
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 14 Region: 5229-5362
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000602
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 15 Region: 5049-5150
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000187
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 2729-2827
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000403
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 17 Region: 1887-2025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000195
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 18 Region: 1481-1635
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000408
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 19 Region: 2094-2207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000054
Family Spectrin repeat 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006570
Domain Number - Region: 4816-4924
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0012
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 3149-3251
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 394-429,615-666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0192
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006570   Gene: ENSMPUG00000006624   Transcript: ENSMPUT00000006683
Sequence length 6899
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:16983895:17256980:1 gene:ENSMPUG00000006624 transcript:ENSMPUT00000006683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPAPPTEDEQVSLDIDDRHFSLQAQQEDTQKKTFTCWINSQLAKHTPPSVVSDLFAD
VKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLKDRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEELARTLSCNYDLPSLDSVSEADSSPTSSPPAKKCSRAQERWQ
ISAKKALLLWAQEQCAPCESVSVTDFKSSWRNGMAFLAVIHALRPDLIDMKSVKQRSNKD
NLNEAFRIAEREFKIPKMLEPEDVDVVNPDEKSIMTYVAQFLRYSKDAAETRDKAQGKMK
DAVIWLTLQEKKLQKALKDSENETYSKKYESLLSFLESFNEEKKPFLDILPVKRNLDELD
EDQLQLREAWDGLTYQINMWETELNRALPSPLCQIEAWLQKVEELIDEDLPASQDYCAAK
ALIQEKITLIKSLMDKCDCHSNTLLTFENGDEQHLPPVPSKKLEEMKRRINNISGKKFIP
RLEFHYYKCSVLGLLDEVKLKLDVWNIKYGNKESVELLLEDWHKFIEEKEFLAQLETSFQ
KCEEIHKNLAGEYQDISEEYTMVEYNVCMYKKYIYNVKSTLQKVLTCWATYMEKLRLLKA
CFEETKKEQIKEVPFETLSQWNLEHTTLNEVGNFLIQVSNDVVGSSISKELRRLNKRWRK
FITKTQLEMNLPLIKKQDQPDFENCENAQLPKEGKPTVDFSRDMSIELPENHNQNIKAGE
EREKENEFTGQFQVAEEVEKLIGQVEIWEAETESLLELLRHQEGVDASVEERLQHLIAKG
SMYEELMSRTEDILQMDVQNISSQESLQHVLTVGLQTKIQEAKEKVQISMVKLVAALKNS
ADAEFNLDVRLKMEESQKELDSYMTRAEQLLGQRESQSGLISKYKEALIILNSKSLAKYL
KAVEELKNNVTEGVKLSLEEESRVACSKWEALHHEMSLYIQQLKIDIEKEKLSDNISRLE
KQINKEKKLIRRGRTKGLIKEHEACFSEEGSLYQLDHHMDVLRELCEELTSQKSQQEMRR
ALKDYEQKIERLRKCASEIRRTLQPTTGGTSKTKETMNTSENGGRDAHREGPSAKSRDQP
STEKNFSLKSKLKPQQEESSMEKSEKDHNAALSCLQERYDIHRENLELYLENNKFRIISD
FSSDKERSSACLQDKLTDLRVLRDETDSCWKEFEFTSLKLEELDSDIKKPLIRNTRDRLK
EKEREFQMTLNTRMESLETALKIVLPVEKESLLLCGSDLLLREIVIQEFHLIDADGIYQN
LRNIQDSIAGQIEIYNNLEQSGDFALKELHPLDLRATREILQKHRTQLEEVNHQVQRSKD
ALTALEEFLASLRTAELSFEPVTDTQVVRENMVRAENKEKEISLMKDQARHLDKRLKTLG
ISFKDAERGDDTCDKLLVALSRKLSETCDDGVHGELTEENKLLETCIFKNNELLKNIQDV
YNQIGKISLKDPSVPAVKQRKKSLTRLDKDLDDYEEEKKWLQEMVNSLPQFKDGREKSLN
EQFQNTALLWESTKASVTECLDQCERVLELLKQYQNFKSVLTALIQKEENVISLQASYMG
KENLKKRIAEIEIVKEEFSEHLEVVDKINQICRNLQFHLNKMRIFEEPPFEKEANIIVDR
WLDINEKTEDYYENLGRALALWDKLFNLKNVIDEWTEKVLRKMELHQLAEDEREKLKEEL
QAYEQKSSEFSTRVANIQFLLQSSEIPLELQVMESSILNKIENVKTHLIGESACSALSGS
PAELREDLDQAKTQIGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMMLLENQIGC
LTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLNDQCKNFNDWFGNIKMNLEECFESLE
TKKSVEQKLQKLSDFLTLEGRGSKIQQVGTVLNHVKKHLPKAHVKELNSWIINQEIELEK
MESVCQARAKELNDYLQQLLRLQDDHSNLSKWLTSQEEKWEEMEKSGEKTELFCEAVARK
REQFESLAQMTSSLKECGLTEEEEIVMESAHLIDRYQAFLRQLCEIDEEDKLPPTEDQSF
NDLAHDVIRWIAGIKESLMALNSSEGKMPLEERIQKIKEIILLKPEGDAKIQTIMSQAES
SKSPLAPKTLTDIKNQWDNTLHLANTYLSHQEKLLLEGEKYLQSKEDLRLMLTELKKKQE
VGFALQHGLQEKKAQLKIYKKFLQKAQDLTSLLKELKSQGSYLLECTKNPNFSEKPWLEI
KHLHESLLQQLQDSVQKLEGHVQEHHSYQLCITDLNATLDDISKEFASFSDMPGDQIGVE
EKLQKLQELENRLRLQDGTLKQILALANSIKQNTSSVGQKIIKDDIKSLMCKQKDLENRL
ESAKQETENCLNSILNSKRSSEQREKFTPPGREKEVTSEVHESTQDSNALEKFEEDCKIN
KNSTVEVVLSKQLSLDVQESMKNTEDEHKVNELQNQPLELDVMLRNEQLKEIEELYAQLE
AKKTAIEPPEQTECLDKAETSALVLHNTGHSVHHLDHLLQALRTSKKNKESQYYLLNDFQ
EHLASVETSVKALLTEKESLKVGPLDSATYLDKIKKFLASVEKEKGSLSKMKIEWENLSK
CLTDMDKKLLESQIKQLAHSWEQVKQLAQKKYSQQAVEHEEFTLLMSEIQDLGSSLQQQQ
QQQQCLQFGPDSPEEEAGCAHMVALATELQIIKHQFSVLKGRAEFQMKRIWGEKEKNTLE
GAVDNLQKQLEASEPLNTQVENQIKKYEIRNKMKEMMLWVKNLLGELTPPISLLPDDILS
QIRKCKVTHDSILEKQQAMESLVEEVKNNIPNLMAGESNDLNHILQDIQNQYQMLILKST
ERSQQLEFKLEERNRFIAVIEKVQLSLQENEALIIPKVRTASTQAELELEQATLTRSQEE
LQEAQGIIAAHLQEQTPVCKDLSVFERLFLDDLLKNLKTRANRTQRFIQNKWNEVEQKRD
FYREFHEKASVLQKEVDHIQRNELLLTQDINGDVKEELYGLKDRITGIQSGILRLLKLKE
AFDSMGLNWDCSQLDQLQALVFEKEKELEEKIKQLDIFMAEYGKYQASLNKLRAVDLQIK
KRAEAVLGTPPTSPESSLLSAQILKRRIEKAMCLCQEIIKKLNESKAFDDSFKEKEILQI
KLYAEENDRIHKILQNGILKSQPQEMDEKDFQDKLENSLHVLNQIKAQLEQPLLLNLDIE
HIQNEKENCEVFHEQVQAEVDGVKAVALTEKQRDENSSDACDVETKLRDIEDLHAQVNTS
IDMRTDVLNDACESITHYNEAVIRAKGILTAREAIVASHKVDLDNPKAPLEMPGWKQEEL
QSTIADIQDLTEKLGTTSSPEAQQQLQSTMQELLSKDSAMTEAAKVKERELERCLENYKC
YRRIKEKICSDLNQMEAVLRQSVFPLPASYKEALERLEQSKALGSKLLSTKEELMKLRQV
LRHLRPACTDSDDMCLLRTTTDLWDKWLNLLEATKEWEIWCEELKWEWKFVSEEIEREAI
ILDCLQEDLPEISKTKEAATTEELCELQDSLCRYQENVEKQQLLLTLLLQRMRSIQNAPK
SLEAVEMIPAFQEITSMQERCNKLFQKAQENKELMENEIQERHSFTKEIITLKNLFQQTA
TYFQNMELQDHPEKVDQFEELQSIFKKGKLTFENIMEKLRIKYSEMYTLVPAEIESQVEE
CRKALEDVDEKISNEVLKSSPSYTMSRKIDEINNGLHSVEKMLQQKSKNIEKAQEIQKKM
WDELDLWHCKLNELDSEVQDIVEQDPGQAQEWMDNLMIPFQQYQQVSQRAESRTSQLNKA
TIKMEEYHDLLRSTEAWIENTSHLLASPTDYDSSKELSQHASTLQMALEDSEQKHNLLHS
IFTDLEDLSIIFETDDLAQSVQELSRQVAALQQKIMESLPQIQRVADDVVAIETEVKSVE
KKVSKIKAVLLSKEIFDFSPEEHLKHGEVILENIRPVKKAIAELMSYQVELQRPQAGMKP
LPVFQRTNQLLQDIKLLDNVTREQNELLRIVIKQTDECNEDIENLKQILNNYSAEFSHEC
VSPDQAANLTEAQGDIEGMEKQILSLNQKKENLLVDLKAAILTLHQHLQQDQPALEQEML
SSGASEEEGVAERDSEWKVNKTGSMSFLPALTEEAEESSLKSENGDKKAEPSSGSWSSLW
KHDRDVEEDRASSSSGTIVQEAAEKISTCDNPVAQSLTSDSPSPNQREEGATPPLKAAAL
GFSDKQGAFESTVEKFGPEPAEILHACKTQVAELELWLHQANVAFEPETLDADMQHVVEQ
QLVGCQAMLTEIEHKVASLLESCKDRGPGDSGATQQEAEALSVKLKTVKCNLEKVQIMLQ
EKHSEDQHSAILKRPSEHQNDLQPDNLSAFESIVTERPQFGRQRDFQQQQVLELKPMEQK
DFIKLIENNAKKMWPQHCQPGKDTTQQSSESIRASNPENDAPDSVLSAQGHSGDKWQYLH
HELSSKLGLPLPKQVQPQVATNMSVLPSVSVYNFRYPTTEELKIYTIQLEDLRQEASNLQ
TQENLTEETYINLDKKLFELFLTLSQCLGSVEETLQTPGLFRGDVCAQQVHYETLALELK
KLYLAMGDKKNDLVKAMAWPGSNTSLFLECFNNLQVYLEHTQATATAKSKSLKAGLDYNR
SYQNEIKRLYDQLSKYKTSLQQSLNEISGQSIDEQLQKADACTVELRNSENRVAKLRDEG
ERLRLPCVLLQEVYKLEDLLDSMWGILRARYMELSSPFITESQQDALLRGMAELVDIGKE
KLAHNHLQQTKSKAALQAQIQNHKLFFQKLVADMLLIRTYANKMLPSLLQKKEMFGAEQI
KEVKLLEEKSHQCGIKLQNLLQKWEEFDENYTSLEKDLEILVSTLPSVSLVEETEERLAE
RISFYQQIKRNIDEKHARLYQTLNEGKQLVASVSCPELEGQIAKLEEQWLALNKKIDHEL
HRLQTLLKHLLSYNRDSDQLTKWLESSQQTLNYWKEQSLNVSQDLDTIRSNINKFFEFSK
ELDNKSSLKAVVVSTGSQLLHLKEADTATLRAALAQLEQKWTTLVTQLPDIQEKLHQLQM
EKLPSREAITEMISWMNNVERHIVGEDSERSLSSAPQVKNLLQKYKEFRMEMDYKQWIID
FVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWQRVHGTLNRKIQHLEQLLESITENE
NKIQILNNWIEAQEERLKTLQKPASVISVQKTLLDCQDIENQLAVKSKALDELRQSYLTL
ESGTVPLLEDTTSRIDGLFQKRSSVINQVNELKTSMQSVLQQWKVCDKLYEEVTMMTIRF
WYCMEHSKPVVLSLEALRCQVESLQSLQDEAEGSEGRWVKLQEVVGKLKDRCPSVAEIME
EKCQSTHARWTQVNQDIADQLQKAQSLLQLWKAYNSAHTEATVRLEQQEAKYQELENINM
SGNNLADILTPALQDVKELQHDVQETKEAFLQNSTLLDRLPQLPESGTHVPRSAQLYSLQ
RAAYLEKMLLVKANEFEFVLSQFKDFGDRLESLKGLIMREEENLDKLYHQEKEENLDLFL
NHVLALTAQSLAVEHLNEVSLKLPVSDIAVKTLQNMNRQWIRATATALEHCSELQGTGLN
KKFLYCCEKWVQLLEKIEETLEVNVADSLPALLEQQKTYEMLEAEVSINQTVADSYVTQC
LQLLDTTEIEKRPEFISKFTKLKDRWQSAAQRIRQRKSDIDGLVGQWRYFTTAAEDLLRF
LNDTCHLLSALKGQDCHSLHQTRRLIRELKSKEIHFQRRQTTFELTLEAGEKLRNTTSLE
TKEMIDKKISQLGDTWKDTKLHVEELIKQLQSNVETWDQCEKKIKELKSRLQVLKAQSRD
PLPELHEDLHREKELIKELEKSLGDWTQNLKELHTMKTDLTRHILVDDVMVLKEQTEHLH
RQWEDLCLRVAIRKQEIEDKLNSWVVFSEKNKEMCAWLVQMENKILQIADIGIEEMIEKL
QKDCMEEINLFSENKLQLKHMGEQLRKASNKTRAAEIEDKLNKVSDRWQHLFDVIGSRVK
KLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQKRLAEQQDLQRDIEQ
HSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEETW
RLWQKFLDDYSRFEDWLKSAERTAAYPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLEL
INKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQKRVTAILRRLRHFTNQREEFEGTRE
SILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKIDQLIVFGEQLIQKSE
PLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSHAPGLEEEKEASENETDMEDPREIQA
DSWRKRRASEEPSSPQSLCHLVPPAPGPERSGCETPVSVDSIPLEWDHTGDVGGSSSHED
DEEGPYYSALSDVEIPENPEAYLKMTTKTLKASSGKSIPEDHSWHVPDSPSCPKLRYKQM
GGDRNVQTIPSDSSTPYKPAYVKLLLSPGTDGGKEGSRVLNGSSQQEDEGLAALGVQQSG
AFDRWELIQAQELRNQLRIKQNLQQVNSEIRDVTTWLKETEAELEMLKRAQPPSDIREME
LRVKRLKEILKAFDTYKALVVSVNMSSKELLQTESAESGELQARVGQLGRRWDMVRGAVE
SWRAGLRRFLLQCQDFHQLSQDLLLWLASAESRRQKAQVTDPNADPQVLLECQEELMRLE
KELGERQPQVNTLREISDSLLVKGRGEDYIEAEEKVHVIEKKLKQLLEQVSQDLMSLQGR
QNPDPSLPSLDEEDGGDQPPAASTPAPPAKFGAERMTTDKSKTDSRVPGPAGPSSSRPQR
SFVSRVIRAALPLQLLLLLLLLLACLLPFSEEDYSCTQANNFARSFYPMLRYTNGPPPT
Download sequence
Identical sequences M3Y5G9
ENSMPUP00000006570 ENSMPUP00000006570 XP_004738963.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]