SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006581 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006581
Domain Number 1 Region: 64-308,416-478
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-41
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006581   Gene: ENSMPUG00000006635   Transcript: ENSMPUT00000006694
Sequence length 486
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:14318507:14328393:1 gene:ENSMPUG00000006635 transcript:ENSMPUT00000006694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRSLQFALGRDVLGRGLGTHRGGSTLDWNGKMSEIKKKIQSVLPGGAWTQLHDTSYLP
PEHSDVVIVGGGVMGLSVAYWLKRLERPRGAIRVLVVERDHTYSQASTVLSVGGIRQQFS
VPENIQLSLFSIDFLRNINEYLAVVDDPPLDIQFNPSGYLLLASEKGAAVLESNVRVQRQ
EGAKVCLMSPEQLRNKFPWINPEGVALASYGMEHEGWFDPWSLLQGLRRKVQSMGVLFCQ
GEVTRFVSSSNHAETPSGEEVTLKRVHEVHVKIDHSLEYQPVECAIVINAAGAWSGQIAE
LAGVGKGPPGTLQGTKLPVEPRKRYVYLWNCPQGPGLETPFVIDASGAYFRREGLGNNYL
GGCSPTEEEEPDPENLEVDHEFFQDKVWPPLAQRVPAFESLKVRSAWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQQAPAVGRAVAEMVLHGNFQTINLSPFLFNRFHLGEKV
HEHNII
Download sequence
Identical sequences M3Y5I0
ENSMPUP00000006581 XP_004750276.1.14098 ENSMPUP00000006581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]