SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006596 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000006596
Domain Number - Region: 133-204
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0885
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006596   Gene: ENSMPUG00000006650   Transcript: ENSMPUT00000006709
Sequence length 309
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897127.1:1623563:1641461:1 gene:ENSMPUG00000006650 transcript:ENSMPUT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPVSLKDNPYITDGYRAYLPSRLCIKS
LFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCS
VGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLVTALAMI
LAVFFAQTHPSYLTQQWQRLRSVIFCSVSGYGVIPTLHWVWLNGGFGAPIVQDFAPRVIV
MYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRHSK
PCPDYASHL
Download sequence
Identical sequences M3Y5J5
ENSMPUP00000006596 ENSMPUP00000006596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]