SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006636 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006636
Domain Number 1 Region: 375-636
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-55
Family Nuclear receptor ligand-binding domain 0.000000019
Further Details:      
 
Domain Number 2 Region: 303-380
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006636   Gene: ENSMPUG00000006690   Transcript: ENSMPUT00000006749
Sequence length 638
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:6022976:6061637:1 gene:ENSMPUG00000006690 transcript:ENSMPUT00000006749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAVQTYGSEYTTEIMNPDYAKLTMDLGSTEITATATTSLPSFST
FMEGYSSNYELKPSCLYQMQPSGPRPLIKMEEGRAHDYHHHHHHHHHHHHQQQQPQQPQQ
QPSIPPPSGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDALPSAQGCIAPGPLL
DPPMKAVPTVPGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLTLGAAAAAAA
AAASRQAAALEGHPYGLPLAKRAAALAFPPLGLTASPTASSLLGESPNLPSPPNRSSSSG
EGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCR
FQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTD
STPRDLDYSRYCPAEQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTL
LIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLSLQSLN
LDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPSEPKVLGALV
ELRKLCTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences M3Y5N5
XP_012909264.1.14098 XP_012909265.1.14098 ENSMPUP00000006636 ENSMPUP00000006636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]