SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006679 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006679
Domain Number 1 Region: 884-964
Classification Level Classification E-value
Superfamily E set domains 6.58e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000702
Further Details:      
 
Domain Number 2 Region: 1070-1178
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000746
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006679
Domain Number - Region: 1532-1642
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00077
Family Motor proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006679   Gene: ENSMPUG00000006733   Transcript: ENSMPUT00000006792
Sequence length 1692
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:1670076:2470549:-1 gene:ENSMPUG00000006733 transcript:ENSMPUT00000006792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRAIPVCTRSTAVFSYDHGNSNSSHVKIFLPKKLLECLPKCSSLPKERHRWNTNEALT
THLFMGAARRGPRRAGAVSAGTWDSALAELEIAAYLITFEKHEEWLTTSPKTRPQNGSMI
LYNRKKVKYRKDGYCWKKRKDGKTTREDHMKLKVQGVECLYGCYVHSSIIPTFHRRCYWL
LQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWT
CSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGSSGHHKCNSAKHRIISP
KVEPRTGGYGSHAEVQHNDVSEGKHEHSHGKGSSREKRNGKVAKPVLLHQNSTEVSSTNQ
VEVPDTTQSSPVSISSGLNSDPDMADSPVVTGVSSMAVASVMGSLSQSATVFMSEVTNEA
VYTMSPTTGPNHHLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVLST
TLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSTNVRHSPPVDRGFGFTTVL
TKEIKTEDTSFEQQMAKEAYSSSAAAAASSSLTLTTGSSLLPSGGGLSPSTTLEQMDFSA
IDSNKDYTSSFSQTGHSPHVHQTPSPSFFLQDASKPLPLEQNAHGSLSDSGGSFVMPTVK
TEASSQTSSCSGHVETRIESASSLHLMQFQANFQAMAAEGEVTMETSQVAEGGEGLIKSG
ELQACSSEHYLQPENTGVIRGAGGVPVLPGNVVQGLYPVAQPGLGNASNMELSLDHFDIS
FSNQFSDLINDFISVEGGSGTIYGHQLVAGDGAALSQSEDGARAPFAQAEMCIPCCSPQQ
GSLQLSGAEGGAGTMAYMHVAEVVSASPAQGALGMLQPSARVFMVTDYSPEWSYPEGGVK
VLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSV
VFEYKARALPTLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKPGSGGGAS
GGGSGTGNGGSQAQCASGPGTLGSCFENRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTL
LHLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHLEAAVV
LYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRMHCPPSEEP
STESWMTQWHSEAISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKL
NPEYFQARQEKLLSTALSLEQPNIRKQSPSSKQCVPETISPSEGVRDCIRETSPPTPETA
GFQASGSQPVVKWNSKGLYIGVSTVQVTGNPKGTSVGEDAAPSQVRPRGPTSVLMMANRE
VVDSEMGSYRDSAERAECSQPMDEIQVNMMTLAEHIIEATPDRIKQESFVPTEPSALERP
DTATISSTMSWLASYLADVDRLPSAAQIRSAYNEPLTPSSNTSLSPVGSPVSEMAFEKPS
LPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQQE
VAAAVIQRCYRKYKQLTWIALKYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQ
KYYRSYKKCGKRRQARRTAVIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLY
KRSERVEKGQGT
Download sequence
Identical sequences M3Y5S8
ENSMPUP00000006679 ENSMPUP00000006679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]