SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006688 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006688
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006688   Gene: ENSMPUG00000006742   Transcript: ENSMPUT00000006801
Sequence length 551
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:7151090:7158060:1 gene:ENSMPUG00000006742 transcript:ENSMPUT00000006801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIATSAQLARALYDNTAESPQELSFRRGDVLRVLQREGAGGLDGWCLCSLHGQQGIVPA
NRVKLLPAGPAPQPGSPSPAPEHSNEDQEVYVVPPPARPCPTVGPQAGPCLPSPDPIYKV
PRGSGTQTAAPGDALEVYDVPPTALRVPSNGPYDSPASFSRPLAQGALQPPGEDEAPYDV
PLAPKLPSELEADLEWEGGREPEPPLYAAPSNLKRASALLNLYEAPEELLADGEGGGTDE
GIYDVPLLGPEAPPSPEPPGASASNDLDALALLLARSPPLPHRPRLPSAESLSRRPLPAL
PVPEAPSPSPAPSPAPGRKGSIQDRPLPPPPPRLPGYGGPKVEEDPEGREVEDDPAGPHN
EYEGIPMAEEYDYVHLKGMDKAQGCRPLDKACPGDPELLERGLPEQQEAPCPEEPLDLPT
GDLQLLHFYAGQCQSHYSALQAAVAALTSSTQANQPPRLFVPHGKRVVVAAHRLVFVGDT
LGRLAASAPLRAQVGAAGTALGQALRATVLAVKGAALGYPSHPAAQEMAQCVAALAGQAL
QFTTLLSSLAP
Download sequence
Identical sequences M3Y5T7
XP_004755367.1.14098 ENSMPUP00000006688 ENSMPUP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]