SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006696 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006696
Domain Number 1 Region: 14-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-46
Family N-terminal domain of xrcc1 0.000000533
Further Details:      
 
Domain Number 2 Region: 552-642
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-22
Family DNA-repair protein XRCC1 0.0000076
Further Details:      
 
Domain Number 3 Region: 332-416
Classification Level Classification E-value
Superfamily BRCT domain 3.53e-22
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006696   Gene: ENSMPUG00000006750   Transcript: ENSMPUT00000006809
Sequence length 646
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:5704477:5726292:1 gene:ENSMPUG00000006750 transcript:ENSMPUT00000006809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSFAPGAAQDVNMPEIRLRHVVSCSSQDLTHCAENLLKADTYRKWRAAKAGEKTISVVL
QLAKDKGILPVSDTVGNDGDAQITCLLQQSKAGGRGRGKESVLLVTSSFMSPSESRSGSN
PNRVRIFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPYGLSFIRFHSPPDKEEAEASPQK
VTKLGQFRVKEEDEGANSLRPGALFFSRINKTPPATASDPAGPSYAAATLQASSAASSAS
PVSRAVGSTSKPQESPRGKRKLDLNQEERKTPSKPSAQPSPPAVKRPKLPAPTRTLATTP
VPAPARGTVPGKSREGTEPRGPRAGPQELGKILQGVVVVLSGFQNPFRSELRDKALELGA
KYRPDWTPDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPS
SSSEDEGGSHSNSSGDEAPKLPRKRPQTKTKPPQAAGPSSPQRPKTPEEAKPASPGPQED
TDTDGEQSEERGNAAEDSGDTEDELRRVAEQREQKQPPDQGENGEDPYAGSTDENTDNEG
PPESPELPVPELPDFFQGKHFFLYGEFPGDERRKLSRYVTAFNGELEDYMSDRVQFVITA
QEWDPSFEEALMDNPSLVFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences M3Y5U5
ENSMPUP00000006696 ENSMPUP00000006696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]