SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006723 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006723
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.13e-92
Family Calponin-homology domain, CH-domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 2166-2285
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-33
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1528-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1636-1789
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 1005-1160
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-27
Family Spectrin repeat 0.00000543
Further Details:      
 
Domain Number 8 Region: 1847-2001
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 1225-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-25
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 10 Region: 815-949
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-25
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.00063
Further Details:      
 
Domain Number 14 Region: 1345-1443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000563
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 15 Region: 2007-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000403
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006723   Gene: ENSMPUG00000006777   Transcript: ENSMPUT00000006836
Sequence length 2322
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:17732634:17854475:-1 gene:ENSMPUG00000006777 transcript:ENSMPUT00000006836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATEFENVGNQPPYSRINARWAAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFKV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLATELLTWIEQTIAVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRNELIRQEKL
EQVARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVRAITAATLQFAEEKGY
QPCDPQVIRDRVSHLEQCFEELSNMAAGRKAQLQQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEAEGMVARKQFGHPQIEARIKE
VSAQWNQLKELAAYRKKNLQDAENFFQFQGDADDLKTWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALRELYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLTQMEIPDTLEDLEVARHRFDILDQEMKTL
MTQIDGVNLAANSLVDSGHPRSGEVKQYQDHLNDRWQAFQTVVSDRRKAVNSALRVRNYC
VDCEETSKWIEDKMQVVRAMKDLAGIIAIQRKLSGLERDVAAIQDRVGALEQESQQLMAS
HPEQGEDIGQWQACVETLWQQLQEALKEQEASLGEASKLQTFLQNLDDFQAWLSMAQKSV
ASEDMPESFPEAEQLLQQHVAIKDDIDRHQENFQKVKESGKNVIRDQTDPEYLLLRQRLE
GLDAGWDALCRMWESRNHSLAQCLGFQEFQRDAKQAEAILSNQEYTLAHLEPPDSLEAAE
VGIRKFEDFLVSMENNEDKVLSPVDSGNKLVAEENLYSDKILEKVQLIEDRHKKNKEKAE
EASVILKDNLELQHFLQNCQELTLWINDKLLTSQDVSYDDARNLQNKWAKHQAFMADLAS
HQGWLDSIDAEGKQLMEEKTQYTARVAQRLEDLHRLWDELQATTQERAQHLSAARSSYLR
SQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELLAQVPS
LGEEAGDTDMSIERRFLDLLEPLERRKKQLESSRAKLQITRDLEDETLWVEERLPLAQSA
NYGTNLQNVQLLMKKNQTLQNEILGHAPRVEDVLQRGRQLLEAAEIDCQDIQDRLGHLQD
AWDALQEAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQEFYIISDEIPKDEESAIVMLK
RHLRQQHALEEYGRNIKQLATRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKEVAEERRR
KLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQ
ERVDNVNIIIEQLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFY
TGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLELQVQQFQDVAGRLQK
AYAGEKAETIQNKEQEVSAAWQALLEACAGRRTQLVDTADKFRFFSMARDLLSWMESVIR
QIETQEKPRDVSSVELLMKYHQGIKAEIDTRSKNFSACLELGESLLERQHQASEEISEKL
KQVLSRRKEMDAKWEDRQEQLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDGV
EKLIRRHEAFEKSTASWAERFAALEKPTTLELKERQTPDRPEEESGSQEEEGETAGEAPR
GPHRAATERTSPGEEKSQWPQDLQPPLLPGPQEKSSGDERPATEPLFKVLDTPLSEGDEP
TTLPAQRDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKDAKNLAL
GVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQGVSTA
INESQSIRIKAQSLPLPSVTGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences M3Y5X2
XP_004738990.1.14098 ENSMPUP00000006723 ENSMPUP00000006723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]