SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006734 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006734
Domain Number 1 Region: 356-578
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.0000837
Further Details:      
 
Domain Number 2 Region: 583-715
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-27
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 109-197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000548
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006734   Gene: ENSMPUG00000006788   Transcript: ENSMPUT00000006847
Sequence length 1036
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:2714271:2739314:1 gene:ENSMPUG00000006788 transcript:ENSMPUT00000006847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKGRAAKVCHHAECQQLHRRGPLNLCEACDSKFHSIMHYDGHVRFDLPPQGSVLARNVS
TRSCPPRTSPAVDLEEEEESSVDGKGDRKSTGLKLSKKARRRHTDDPSKECFTLKFDLNV
DIETEIVPAMKKKSLGEVLLPVFERKGVALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRV
KAKPGDEGKVEQGVKDSKSLSLPVLRPARAGTPSLERADPQSRRESLDILAPGRRRKNMS
EFLGETSIPGQEAPAPSSCSLPSGSSGGGDSWKNRAASRFSGFFSSGPSTSTFGREVDKM
EQLEGKLHAYGLFGLPRLARRLRFDHDSWEEEGDEEEEEDDACLQLEDSWRELIDGHEKL
TRRQCHQQEAVWELLHTEASYIKKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEI
ARLHRGLWASVMAPVLEKARRTRAPLQPGDFLRGFKMFGSLFKPYVRYCLEEEGCMEYMR
GLLRDNDLFRAYVTWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRRTDEPRAKEA
VVTMIDSAERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVEGGNDEVDKLLKEFLHLDL
TAPIPGASPEETRQLLLEGSLRMKEGKDGKMDVYCFLFTDLLLVTKAVKKAERTKVIRPP
LLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDAIYNAQNQLQQLR
AQEHPGSQQHLQSLEEEEDEQEEEDDEEEEEEEGGESSTSAASSPTILRKSSNSLNSQHC
ASDGSTETLAMVVVEPGETPSSPEFEGGPFSSQSDETSLSTTASSVTPTSELLPLGPVDG
RSCSMDSAYGTLSPTSLQDFAAPTPAGEPVPRPPELPQAPSPPPSPRLRRRTPVQLLPRL
PHLLKSKSEASLLQLLSGATTCRAPPSPSRSLSELCLAVTVPGTRTQGFPREAGSSGARR
GTQNPGHGSEPSELEGRTSCLVGEPERPARRSKELPRVQPEPPPGISAQHRKLTLAQLYR
IRTTLLLNSTLTASEV
Download sequence
Identical sequences M3Y5Y3
ENSMPUP00000006734 ENSMPUP00000006734 XP_012920129.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]