SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006747 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006747
Domain Number 1 Region: 363-440
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.05e-23
Family Intermediate filament protein, coiled coil region 0.00053
Further Details:      
 
Domain Number 2 Region: 131-165
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000277
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 172-241
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000035
Family Intermediate filament protein, coiled coil region 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006747   Gene: ENSMPUG00000006801   Transcript: ENSMPUT00000006860
Sequence length 469
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:2313821:2361605:1 gene:ENSMPUG00000006801 transcript:ENSMPUT00000006860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQFTYKSGVATKGGFSGCSAVLSGGSSSSYRAGGKGFSGGFGSRSLYSLGGTRSISLN
MASGSGRAGGYGFGRGRASGFAGSMFGSVALGPVCPSVCPPGGIHQVTINKNLLAPLNVE
LDPEIQKVRTQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLE
PILEGYISNLRKQLETLSGDRVRLDSELRSMRDVVEDYKRRYEEEINKRTTAENEFVVLK
KDVDAAYMSKVELQAKVDALDGEIKFFKCLYEGEIAQIQSHISDTSVILSMDNNRNLDLD
SIIAEVRAQYEEIALKSKAEAEALYQTKFQELQLVAGRHGDDLKHTKNEISELTRLIQRL
RSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEAALHQAKEELARMLREYQEL
MSLKLALDMEIATYRKLLEGEECRLEGDVEGNSGEKGLWVAPCWAGDIW
Download sequence
Identical sequences M3Y5Z6
ENSMPUP00000006747 ENSMPUP00000006747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]