SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006780 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006780
Domain Number 1 Region: 377-499
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-22
Family Pleckstrin-homology domain (PH domain) 0.00000173
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006780
Domain Number - Region: 260-371
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000164
Family Synaptotagmin-like (S variant) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006780   Gene: ENSMPUG00000006834   Transcript: ENSMPUT00000006893
Sequence length 1159
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:15757662:16281821:1 gene:ENSMPUG00000006834 transcript:ENSMPUT00000006893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRQQKLNKQQLQLLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSG
GCSANDFREVFKKNIEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDMCKQSNRMAL
SAVSELILSKEQLYEMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLAEK
MAKERNFPKFITKEMETMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFL
DIGDENEIQLSKSDVVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGGEKLQTDQAEAS
RPQWGTQGDFTTTHPRPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAEFHRMIV
PKNSQDSDLKIKLAVRMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSY
REKKSEPQELMQLEGYTVDYTDPHPGLQGGQMFFNAVKEGDTVIFASDDEQDRVLWVQAM
YRATGQSYKPIPVIQTQKLNPKGGTLHADAQLYADRFQKHGMDEFISANPCKLDHAFLFR
ILQRQTLDHRLNDSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLTELMEHSENGAV
IDPTLLHYSFAFCASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPF
GRPEGALKATLSLLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEGPA
EKEAETMNQAPPARKLEEVLHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWA
LFTVDMDTALEAQPQDSWDSFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDL
MESSIAQSIHRGFEQETWQPVNNGSATSEDLFWKLDALQMFVFDLHWPEQEFAHHLEQRL
KLMASDMIEACVKRTRTAFEAKLQKASKTTELRIPASVCTMFNVLVDAKKQSTKLCALDG
GQEFGSQWQQYHSKIDDLIDNAVKEIISLLVSKFVSVLEGVLSKLSRYDEGTFFSSILSF
TVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILREKVNEEMYIEKLFDQWYSSSMKVICV
WLADRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTYDTLHRRLTVEEATASV
SEGGGLQGITMKDSDEEEG
Download sequence
Identical sequences M3Y629
ENSMPUP00000006780 ENSMPUP00000006780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]