SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006824 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006824
Domain Number 1 Region: 616-1016
Classification Level Classification E-value
Superfamily RNI-like 1.1e-66
Family 28-residue LRR 0.0000659
Further Details:      
 
Domain Number 2 Region: 43-129
Classification Level Classification E-value
Superfamily DEATH domain 4.59e-24
Family Pyrin domain, PYD 0.013
Further Details:      
 
Domain Number 3 Region: 207-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000117
Family Extended AAA-ATPase domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006824   Gene: ENSMPUG00000006879   Transcript: ENSMPUT00000006938
Sequence length 1023
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897135.1:1674940:1695644:-1 gene:ENSMPUG00000006879 transcript:ENSMPUT00000006938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVNLNSSSQFSPCSSSSSSSTPSPCYLISSLMSSASSNSPFENGVMLYMAYLSKEGLQ
TFKQLLVDENPRPGSVQITWDQVKTARWGEMVHLLVEFFPGRLAWDVTHDIFAKMNQTEL
CLRVQMELNYILPNLELKDLNPREMPVNLEEGESDKIQEYKVHVTNEYSMMRTMTTWSGS
HADFFYQDIERHERFLPCLFLPKRPQAKQPKTVVLQGVAGVGKTSLAKKVMLEWAENKFY
CHKFRCAFYFHCQEMAQVDEQSFAELIAHKWPGSRSLMSKIMSKPDQLLLLFDGFEEVSL
TLTDRPADLSDDWIQKLPGPVLLASLLSKRMLPEATLLITFRFTSWRKLKPFLKHPSFIT
LTGFSMAERAKYFRTYFGNKRDADEALRFVTGNTVLFSMCQVPAVCWMVCSCLRQQMQRG
ADLAQAYPNATAVFVQYLSGFFATKPGSPPRNTHQTRLAGLCYLAAEGMWNMRWVFDTKD
LEQAKLDETAVATFLHMNIFQRVAGDGDRYAFAILSFQEFFAAFLYVLCFPQRLRNFRVL
DRVQIIRLIAYPGRKKNYLAQMGLFLFGLLNEKCASAAEKSFGCKLSLGNKKKLLKVAAL
LHECSPPTLHHGVPQLFYCLHEIQEEAFVRQTLSDCQNATLIISKKKDMQVSAFCLKYCQ
RLRALELTMTLTIPHVGTLSVDPLHSAEPESSDQCFLWWQEFCSVFRTHENLEVLTLTNT
SLEAESVKVLSAALRHPGCKLQKLIFRRVHPSMLNEDLIQVLTENQYLSYLEIQGTEVRR
EAMEFLCTALKCPQCYLQCLRLEDCSVTPKSWIDLAKDLGSNKSCKSLSLTDSSVFSQEG
CYPLLQDLLALRLENCELALLTCKTLTSSLKSNEMLTHLSLAENTLKDEGTKELCNALQC
STCPLQRLVLRNCALTSDCCPDLVSALDKNKNLKSLDLGFNSLKDDGVILLFEALMKPQS
GLQILELEKCLLTAVCCQAMASMVLHNQSLRYLDVSKNDIGLRGRELLREAFQQRKGEKK
VVL
Download sequence
Identical sequences M3Y673
ENSMPUP00000006824 ENSMPUP00000006824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]