SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006850 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006850
Domain Number 1 Region: 651-752
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-24
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006850
Domain Number - Region: 299-411,651-671
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0115
Family BAR domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006850   Gene: ENSMPUG00000006905   Transcript: ENSMPUT00000006964
Sequence length 757
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:5755170:5775172:1 gene:ENSMPUG00000006905 transcript:ENSMPUT00000006964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRAGQTGLPPPSGAVGPVVPRSTSGLLGRGTEQLFSPPSSPATCPADRKVSAQSAEG
SARKPEPAPPPGALSKHRRAREPPGTQPRAVRPRPRNSGPPTPLERRAVMGTPSGRDRGC
WPPPAPEGDAEVSPQGAAQSQMHPEDPQEPEAPEAPEEPQGVKELPSGRGAEQQAEEEEE
VEEGSSTESSRDAGEAPPPAPTPVTPPASPQPGERVRGAARRLREQQLEALTRVALMEQR
VKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQGDTEQGSREQREQ
EQRQLSQERDRVEGLRQRLQEAQGQLDSQPEEQREWLLQGVQEMREQLDVAQRAYEDLEF
QQLEQESRREEEDRDSTGARALDPKVQELQASVAQHRRRIQVLEEQLKSLGEQMAAESRG
LSRKKEEALQALTQERGRLLQLNCLQGTPGGDFAESNQALTKLLFTQKTDRQLLVLQDPT
AHTASATSSCLFSVRSSLQGSIGLQRTGSLPRKRGERVSQRGSPRPMSLHYTGPLEASAL
PAASGNSGRHPLYQLLNCGPGNSCGALHPDIARMERLLQQAVAERERLLKAREGMRRNKE
VSSGPDVPAIMAPPMPPPHPPGPRVLDLRQHLERWGHNPESCPHLRVSGGCCRGSLVKMG
GRIKTWKKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNPRLT
FCVKTYERLFYMVAPSPEAMRIWMDVIVTAADENHAL
Download sequence
Identical sequences M3Y699
ENSMPUP00000006850 ENSMPUP00000006850 XP_012919566.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]