SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006872 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006872
Domain Number 1 Region: 690-829
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000774
Family Synaptotagmin-like (S variant) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006872   Gene: ENSMPUG00000006927   Transcript: ENSMPUT00000006986
Sequence length 853
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897097.1:1285439:1296440:1 gene:ENSMPUG00000006927 transcript:ENSMPUT00000006986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRPRKGPQASGQGVAAAKQLGLFVEFSPEDMLLGMEETEDDGDLEAELLALTGEAGA
SGKKPTTKGQAPLPMAHIEKLAADCMRDVEEEEEEEGLEEDADLLTELQEVLGANEETGS
LDGDKTASPGGSEEEKGQEDTEAPVQRAPLTASIPAAQAGGPRGLQALLEDRIHNYREAA
ASAKEAGEAAKARRCERGLKTLEAQLAAVRKGRKISEDEIPPPVALGKRQPVPQETTDRN
PEADAPAPFTVEPDKSSQMETSLLGGPGISAPPDSDPDPQALLLARQREYKLAALNAKRA
GDLDRARELMRIGKRFGAVLEALEKGQPVDLSAMPPAPEDLKPLPQASRTLTAPSAVSPA
VERVQPVMASDTPAAPGVPAEPQTVLDALQQRLNKYREAGIQARSSGDERKARMHERIAK
QYQDAIRAHRAGRRVDFAELPVPPGFPPIPGLEPTTGTEDDAVAATLAAAQKLVSAEDTA
PAEENEDEDESPAQAPVAKKPAKPVVPSFRAVPESKASSSRESVSPSVREQLALLEARKL
QYQRAALQAKRGQDLEQAKAHLRVAKCLEAQITQVRAGRPVDLSKVPSPLTDEEGDFILI
HHEDLRLSQKAEEVYAQLQKMLLEQHEKCLLFSKQFMHQGNVAETSKFENLAQDRKKQLE
ILQLAQAQGLDPPSHHFELKTFQTVRIFSELNSTEMHLIIVRGMNLPAPSGVTPDDLDAF
VRFEFHYPNSDQAQKNKTAVVKNTNSPEFDQLFKLNINRNHRGFRRVIQSKGIKFEIFHK
GSFFRSDKLVGTAHVKLERLENECEIREIVEVLDGRKPTGGKLEVKVRLREPLSGQDMQV
VTENWLVLEPRGL
Download sequence
Identical sequences M3Y6C1
ENSMPUP00000006872 XP_004774519.1.14098 XP_004774520.1.14098 XP_012902298.1.14098 ENSMPUP00000006872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]