SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006887 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006887
Domain Number 1 Region: 423-598
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.12e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 600-701
Classification Level Classification E-value
Superfamily E set domains 1.68e-27
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006887   Gene: ENSMPUG00000006942   Transcript: ENSMPUT00000007001
Sequence length 1037
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:18894278:18996712:1 gene:ENSMPUG00000006942 transcript:ENSMPUT00000007001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTANCGAHDELDFKLVFGEDGAPAPPPSGSRPADLEPDDCASIYIFNVDPPPSTLNSST
LNLPHHGLPSHSSVLSPSFQLQGHKSYEGTCEIPESKYSPLGGPKPFECPSIQITSISPN
CHQEVDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEDSWHQQYGLGHSLSPRQ
SPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLNASVQGGSGLGPAPFPFQYCVETDIPLKTRKTSEDQATVLPGKLELCS
DDQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWNKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQVDGRPQWEVEGKIIREKCQGA
HIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPAL
SVPHPAQTQRPSSDTGHPHDSVLSTQRNLVCPIQQTYASMVTSSHLPQLQCRDESSGKEQ
HMISSSVMHQPFQVTSAPPVGSSYQPMQTNVVYNGPTCLPVNAASSQEYDPVLFPQDAPL
PSLINLGCQPPSSIPFHSSNSGPAGHLLAHTPHSVQTLPHLQSVGFHCSNTGQRSLSSPG
ADQVTGQPSPQLQPITYGPSHSGSATTASPGASHPLASSPLSGPPSPQLQPMPYQSPSSG
TASSPSLATRMHSGQHSTQAQSTGQGGLSAPSSLICHNLCDPASFPPDEATVNIKPEPEE
QEPNFSTIGLQDITLDD
Download sequence
Identical sequences M3Y6D6
ENSMPUP00000006887 ENSMPUP00000006887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]