SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006918 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006918
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006918   Gene: ENSMPUG00000006974   Transcript: ENSMPUT00000007033
Sequence length 203
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:2913234:2914430:-1 gene:ENSMPUG00000006974 transcript:ENSMPUT00000007033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKPGTQASSSSHSSSFRKISKPLMEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEK
ADILELSVKYMKSLQNSVQGLWPVPLGAEFPSGFRSCLPGVGQLLRRREEGGGGLRCPLA
HERAGGSTMDSASPSREAPEPLGPCAPAVWAPAPATGGSRSPPPRLLFPGGLPGPSSSVP
GPQPAPRRCAESPGPRLGVWRPW
Download sequence
Identical sequences M3Y6G7
ENSMPUP00000006918 XP_004768753.2.14098 ENSMPUP00000006918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]