SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006949 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006949
Domain Number 1 Region: 415-476
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000155
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 473-543
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000002
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006949
Domain Number - Region: 385-418
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00124
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006949   Gene: ENSMPUG00000007005   Transcript: ENSMPUT00000007064
Sequence length 575
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897067.1:94022:102299:1 gene:ENSMPUG00000007005 transcript:ENSMPUT00000007064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPPPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPSAAGVQRAQMGRV
GEIPPPPPEDFPLPPPPVLGDGDDSEGALGGAFPPPPPPVEEPFPSEALEEEIFPSPPPP
LEEEGGPEAAVPPPPQPREKVSSIDLEIDSLSSLLDDMTRNDPFKARVSSGYVPPPVATP
FVPKSSTKPAAGGTAPLPPWKSPSSSQPLPQAQAQAKPPSQTQFHVQPQAKPQVQFHVQP
QPQAHPQPVPSANTQPRGPPAPSPAPKFSPVPPKFTPVASKFSPGAPGGPGSQPSQKLGS
AEPPSSSSTGSPQPPSFTYAQQKEKPRVQEKQHPVPPPAQNQNQGRSPGAPGPLTLKEVE
ELEQLTQQLMHDMEHPQRQNVAVNESCGRCRQPLARTQPAVRALGQLFHVPCFTCHQCEQ
QLQGQQFYSLAGAPYCEGCYTDTLEKCDTCGQPITDRMLRATGKAYHPQCFTCVVCACPL
EGTSFIVDQANRPHCVPDYHKQYAPRCSVCEGPIMPEPGREETVRVVALDKNFHMKCYKC
EDCGKALSIEADDNGCFPLDGHVLCRKCHTARAQT
Download sequence
Identical sequences M3Y6J8
ENSMPUP00000006949 XP_004772120.1.14098 ENSMPUP00000006949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]