SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006996 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006996
Domain Number 1 Region: 410-771
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.01e-118
Family Oxysterol-binding protein 0.0000114
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-24
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006996   Gene: ENSMPUG00000007053   Transcript: ENSMPUT00000007112
Sequence length 777
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897097.1:1839664:2000883:-1 gene:ENSMPUG00000007053 transcript:ENSMPUT00000007112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYRRVTSGRLLSLAAPKMASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKM
MRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHT
LQLQISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKL
FDDKLQNCKDDEQRKKIETLKETTNSMVESIKHCIVLLQIAKDQCNAEKHADGIISTINP
VDAIYQPSPLEPVINTMPTQTVLPPEPSQLCKSEQRPSSLPVGPVLTTLGHHQTPTPNST
GSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSAS
VLTHSSSGNSLKRPDTTESLNSSMSNGTSDADLFDSHDDRDDEGEAGSVEEHKSVIMHLL
SQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDARDRMVQVVKWYLS
AFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNCVTFVAEQV
SHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPN
GYGRSILTVPWVELGGECNINCSKTGYSANIVFHTKPFYGGKKHRITAEIFSPNDKKSFC
SVEGEWNGVMYAKYATGENAVFIDTKKLPIIKKKVRKLEDQNEYESRCLWKDVTFNLKIR
DIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences M3Y6P5
ENSMPUP00000006996 ENSMPUP00000006996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]