SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007017 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007017
Domain Number 1 Region: 126-234
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-28
Family DEP domain 0.00000279
Further Details:      
 
Domain Number 2 Region: 238-351
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-25
Family Pleckstrin-homology domain (PH domain) 0.00000202
Further Details:      
 
Domain Number 3 Region: 4-136
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007017   Gene: ENSMPUG00000007074   Transcript: ENSMPUT00000007133
Sequence length 353
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:19968441:19987743:-1 gene:ENSMPUG00000007074 transcript:ENSMPUT00000007133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLLYYKLEGGRKVTPPKGRILLDGCTITC
PCLEYENRPLLIKLKTRTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHILKNS
FKLPPHISLHRIVDKMHDSSSGIRPSPNMEQGSTYKKTFIGSSLVDWLISNSFSANRLEA
VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISSKEEISLS
TVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT
Download sequence
Identical sequences M3Y6R6 U6CWE6
XP_004739034.1.14098 ENSMPUP00000007017 ENSMPUP00000007017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]