SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007027 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007027
Domain Number 1 Region: 469-533,575-673
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-31
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 681-805
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1093-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-18
Family Second domain of FERM 0.0071
Further Details:      
 
Domain Number 4 Region: 994-1071
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000827
Family Ubiquitin-related 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007027
Domain Number - Region: 19-127,580-600
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00136
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007027   Gene: ENSMPUG00000007084   Transcript: ENSMPUT00000007144
Sequence length 1364
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:20105729:20146139:1 gene:ENSMPUG00000007084 transcript:ENSMPUT00000007144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVETRASVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDAGSLHRKYQDLLKAMRGKDELISQLEAQLEKQKQMRAEEA
KVVQEKAAKIKEWVTLKLGELEMENQHLKSSNEHLAEQVGALQDALEALQMAPSGKLLVA
PQETPEQDSDASGPGVQPIGQDSGPQAKDALKAALPAPSPGALPRRDSGPKAGISLEDSS
SIVVHPGEIAEAKTLPPHLGREGSPRQLCMKPRTHRHGSASWGEGLVTAQGGTLPGTKNS
AREGSPGCSLTLPKARVPSTPRDSIQLAKRHHSQPQVGPGCFNHVVSIEIGNLSALHPSR
LPEVEARAELREEPENMEMGEPPPGGKKEERESPQAPGAELEEVDLGNTPPTPPLHRFPS
WESRIYAVAMAGMRLSDASPRMNATCCASSPPALAFPGPFSGLVYKNVTVPVYTALKGRA
TQISTVPFVDESSGSDDDCCSQASFRTSVPCSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDAYSLDSDYSEPEHKLQRTSSYSAEGPGLAGESLEKSGYLLKMGSRVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVELNSRCQIVRGEGAQTFQLISEKKTYYLTADSPGLL
EEWIRALQSLLKVQAVGPPALPRGGSKPTVKGWLTKVKHGHSKLVWCALVGRTFYYYRSH
EDKRPLGHLPVRDARIEEVDRSCDSDEDYEAGGSRRLLSSHCTLVIHPPEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSATVGTAYEQLIGKLMDGEGDPDSPLWRHPILCYSKDGLYTS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLAHPELQSEIYCQ
LMKQTSGRPPQKCSLIQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRNETGQYATYC
QRAVERTLQTGEREARPSRMEVVSILLRNPFHHSSPFSIPVHFTNGTYQVVGFDGSSTVD
EFLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLHGSIKICDAISKWEQAVKELHSGK
AEGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELALEMAALM
AQVEYGDLERPSPPGPGSPPPAKVQHHLQQVLDRFYPRRYRHGAPPEQLRHLADLLTTKW
AALQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQMFSKDSSLVWIAVNEDGVSILDYS
TMQVHVTYPYSSVMTFGGCRDDFMLVIRSIPDQSSGKGHIEKLLFRMAAPKIAEATFIMA
SYMNHCSATVNPRNNPPAAHRLWELDGQQFFASVPCAARGPTLL
Download sequence
Identical sequences M3Y6S6
XP_004739042.1.14098 ENSMPUP00000007027 ENSMPUP00000007027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]