SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007043 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007043
Domain Number 1 Region: 462-539
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000528
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007043   Gene: ENSMPUG00000007101   Transcript: ENSMPUT00000007161
Sequence length 640
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:207322:227671:-1 gene:ENSMPUG00000007101 transcript:ENSMPUT00000007161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSTTMVLSAASSEAQMVQSLGFAIYRALDWGLDDSEERELSPQLERLIDLMANNDCEDG
VCGAADEGYGGPEEEEEAEGGPRAVRTFAQAMRLCAARLTDPRGAQTHYQAVCRALFVET
LELRAFLARVREAKQMLQKLREGELQEGKPLAELDHLGHTDWGAQARLWVQLMRELRHGV
KLKKVQEQEFNPLPTEFQLTPFEMLMQDIRARNYKLRKVMVDGDIPPRVKKNAHELILDF
IRSRPPLKQVSERRLRPLPQKQRTLHEKILEEIKQERRLRPVRGECWGGRGFGSLPCILN
ACSGDTKSTSCINLSVTDAGSNTQRPRPRVLLKAPTLAEMEEMNTSEEEESPCGEGTLKR
DRSFSEHDLVQLRSEVSSSLQPATQPQGRLESSRPRAGSMHTWRPSTQEQGLFPMSVQAQ
PDPSSRPHSDQGSAEDKPEASTAPDTHHLWLEFSHPVESLALTVEEVMDVRRVLVKAEME
RFLHNKELSSSLRKGKICCCCRAKFPLFSWPPTCLFCKRAVCASCSIKMKMPSKKFAHIP
VYTLGFESPRRVSTTDTTPTQRTEPFQSLQGSQWQSVEEAFPHIYTHGCVLKDVCSDCTS
FVADVVRSSRRSVDALNTTPRRTRQTQSLYVPNTWTLNFK
Download sequence
Identical sequences M3Y6U2
ENSMPUP00000007043 ENSMPUP00000007043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]