SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007050 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007050
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.59e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007050   Gene: ENSMPUG00000007107   Transcript: ENSMPUT00000007168
Sequence length 221
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:11971930:11995328:1 gene:ENSMPUG00000007107 transcript:ENSMPUT00000007168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESNRHTTLSLLTKAKLHIKKLEDCDRKAIHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSSSMKRIKLQDNHKTCLGL
Download sequence
Identical sequences M3Y6U9
ENSMPUP00000007050 ENSMPUP00000007050 XP_004742185.1.14098 XP_021554753.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]