SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007098 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007098
Domain Number 1 Region: 52-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-46
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 275-336
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000112
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000968
Family Pseudo ankyrin repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007098   Gene: ENSMPUG00000007155   Transcript: ENSMPUT00000007216
Sequence length 475
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:20433617:20490041:1 gene:ENSMPUG00000007155 transcript:ENSMPUT00000007216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCTLRGLAVAGGGESSESEDDGWEIGYLDRADQKLKGPLLPEEKNETFKKALTTGDIS
LVQELLDSGISVESSFRYGWTPLMYAASVSNVELVRVLLDRGANASFDKDKQTILITACS
ARGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHPQVVALLVAHGAEVNSQDE
NGYTALTWAARQGHKNVVLKLLELGANKMLQTKDGKTPSEIAKRNKHLEIFNFLSLTLNP
LEGKLQQLTKEETICKLLTTDSDKENDHLFSSYTAFGDLEIFLHGLGLEHMTDLLKERDI
TLRHLLTMRKDEFTKNGITSRDQQKILAALKELEVEEIKFGELPEVAKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLSKEVCKLK
DLIQKLQNERENDPTHIPLMEEVSTWNSKILKRTAIAVCGVGLLLFVCKLTLQRK
Download sequence
Identical sequences M3Y6Z5
ENSMPUP00000007098 ENSMPUP00000007098 XP_004741964.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]