SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007161 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007161
Domain Number 1 Region: 126-237
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-38
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 60-141
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-22
Family PDZ domain 0.00043
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007161
Domain Number - Region: 274-373
Classification Level Classification E-value
Superfamily PH domain-like 0.00821
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007161   Gene: ENSMPUG00000007219   Transcript: ENSMPUT00000007280
Sequence length 477
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:19844466:19953165:1 gene:ENSMPUG00000007219 transcript:ENSMPUT00000007280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAAATAAAGVGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAXEA
GGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQAL
KRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGASPQSPSFSGSEDSGSPKHQNNTKDR
KVIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALL
PQVLAELNAMLGATSTAGSSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCM
PWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHR
DLSTWTRILVQGCHAAAELLKEVSLGCTINGQEVRFTVHYENGFTISKENGGSSSILYRY
PFERLKMSADDGIRNLYLDFGGPEGELTVDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences M3Y757
ENSMPUP00000007161 ENSMPUP00000007161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]