SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007177 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007177
Domain Number 1 Region: 58-247
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.63e-64
Family Regulator of G-protein signaling, RGS 0.000000019
Further Details:      
 
Domain Number 2 Region: 470-698
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-59
Family DBL homology domain (DH-domain) 0.000000585
Further Details:      
 
Domain Number 3 Region: 699-833
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-38
Family Pleckstrin-homology domain (PH domain) 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007177   Gene: ENSMPUG00000007235   Transcript: ENSMPUT00000007296
Sequence length 987
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:5987256:6009142:1 gene:ENSMPUG00000007235 transcript:ENSMPUT00000007296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTLLSASPVEPMEAEDIARGLAPGPPRPGLVPVSIIGAEDEDFENELETNAEEHNSQF
QSLEQVKRRPAHLMAFLQHVALQFEPGPLLCCLHADMLASLGPKEAKKAFLDFYHSFLDK
TAVLRVPVPPTVSFELDRTRPDLLSEDVQRHFVHDVVQNQQATVSRLLEDFRSKRLMGMT
PWEHDLTQLEAWVGRDRASFEARERHLAERLLTHLEEMQHTISPDEEKSAAVVSAISLYM
RHLGVRTKSGDKKSGRNFFRKKMMGNRRSDEPTKTKKGLSILLDAARWNRGEPQAPDFRH
LKVEADAEKPGLMERRGGLGVPSRDRNVGAPGQDVPGVSPHPLSGDSPDREAGVDAPPEL
GDPPPQGPASLEPLAPPESTEEGADTERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKG
RGGGRSRSDVDMDPSSATAVLGPTRRATPEPGDEGDPARSGLEIEPEEPPGWRELVPLGT
LHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFSLEELQNIFPSLDE
LIEVHSLFLDRLMKLRQDSGYLIEEIGDVLLARFDGAEGRWFQKISSRFCSRQSFALEQL
KAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERE
KVELAAECCREILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSSDPMLSEFKNLDITKK
KLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRP
VLRLTSAITREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCSLITETAGSLKVPA
PASRSKSRPSPSSTREPLLSSSENGNGGGREMPTTDGRTERILSMLLPYSRPGPEGQLAA
KALEKVLSLKQLLFPSEEDSGAGPSREGDGVPGGGSQSQDQTQEIREKLLSLEETMKQLE
EVEEEFCRLRLLLSQLGESAAPQPGCT
Download sequence
Identical sequences M3Y771
XP_004767788.1.14098 XP_012919453.1.14098 XP_012919454.1.14098 ENSMPUP00000007177 ENSMPUP00000007177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]