SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007190 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007190
Domain Number 1 Region: 133-202
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007190   Gene: ENSMPUG00000007248   Transcript: ENSMPUT00000007309
Sequence length 347
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:21603257:21721920:1 gene:ENSMPUG00000007248 transcript:ENSMPUT00000007309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDYQLVNQTPKRSHPPASSSALLVQQGHLSPESDTGFTGNPLTKLLTLGKEDDNVEWH
MEDVIEDIIGMESSFKEEGTDSPLLMQRTLSGSILDVYSGEQGISPVNMGLTSASCPSSL
PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT
ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARAHGLPALASLGA
VDLGANVTKQQTHLEQNSVDYCQQLTLSQGTSPELCDQAMAFSDPLSHFTDLSFSAALKE
EQRLNDMLLDDTISPFGTDPLLSAISPAVSKESSRRSSFSSNDGNEL
Download sequence
Identical sequences M3Y783
ENSMPUP00000007190 ENSMPUP00000007190 XP_004741986.1.14098 XP_012906448.1.14098 XP_012906450.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]