SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007195 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007195
Domain Number 1 Region: 210-277
Classification Level Classification E-value
Superfamily Homeodomain-like 4.02e-21
Family Homeodomain 0.0034
Further Details:      
 
Domain Number 2 Region: 97-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000137
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 66-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000457
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007195   Gene: ENSMPUG00000007253   Transcript: ENSMPUT00000007314
Sequence length 363
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897115.1:210726:235320:1 gene:ENSMPUG00000007253 transcript:ENSMPUT00000007314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGSLDKDEGRASPCTPSTPSVCSPPSAAS
SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCK
MDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVL
CRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQ
DNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSED
IHYSPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVIL
FQY
Download sequence
Identical sequences M3Y788
XP_004775633.1.14098 ENSMPUP00000007195 ENSMPUP00000007195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]