SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007214 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007214
Domain Number 1 Region: 57-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007214   Gene: ENSMPUG00000007271   Transcript: ENSMPUT00000007333
Sequence length 224
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:12711089:12717473:-1 gene:ENSMPUG00000007271 transcript:ENSMPUT00000007333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAPAPALLGVPPAEVLEDLLREQFGPLPQLAAVCRLKRLPSGGYSSTEDLQLVLERRR
VANAKERERIKNLNRGFAKLKALVPFLPQSRKPSKVDILKGATEYIQVLSDVLEAAKDSE
RQNPDCQNYRNNPSEAPISLAGDLSRNITQHASCTVGLKNEEKRPWTDGGSGESAYTCCQ
SAMSMTGVLSPTRSLVKCFFLNSHIDVKKPKIFSLRCMEFSRLK
Download sequence
Identical sequences M3Y7A7
ENSMPUP00000007214 ENSMPUP00000007214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]