SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007261 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007261
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 7.91e-34
Family Spectrin repeat 0.000000579
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-23
Family Spectrin repeat 0.00000225
Further Details:      
 
Domain Number 6 Region: 738-840
Classification Level Classification E-value
Superfamily EF-hand 4.03e-19
Family EF-hand modules in multidomain proteins 0.03
Further Details:      
 
Domain Number 7 Region: 843-913
Classification Level Classification E-value
Superfamily EF-hand 2.21e-18
Family EF-hand modules in multidomain proteins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007261   Gene: ENSMPUG00000007318   Transcript: ENSMPUT00000007380
Sequence length 914
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:21280547:21375728:-1 gene:ENSMPUG00000007318 transcript:ENSMPUT00000007380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
APENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFAAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQKKTGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSR
ETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYTGPDAVPGALD
YMSFSTALYGESDL
Download sequence
Identical sequences M3Y7F4
XP_004739060.1.14098 ENSMPUP00000007261 ENSMPUP00000007261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]