SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007268 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007268
Domain Number 1 Region: 292-609
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-91
Family p120GAP domain-like 0.0000276
Further Details:      
 
Domain Number 2 Region: 166-287
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000551
Family PLC-like (P variant) 0.085
Further Details:      
 
Domain Number 3 Region: 114-163
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000143
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007268   Gene: ENSMPUG00000007325   Transcript: ENSMPUT00000007387
Sequence length 1112
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897115.1:569607:650412:-1 gene:ENSMPUG00000007325 transcript:ENSMPUT00000007387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPGQSSALGAATASLKISLPIFVIVWAAGHPVCCFPPSARPLPPAFSPRNMPFSALSLA
GVRTLCTRMRGLVSHLMPRLKESRSHESLLSPSNAVEALDLSMEEEVVIKPVHSSILGQD
YCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAK
KKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERN
SYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEF
AEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNE
HLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQ
GNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCP
AIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNM
QRFLLEISNPETVSNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIISKLGPLPRILRD
VHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENK
DLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPD
ALTADGQAPASQLVAGWPARAAPASLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSF
QNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSSAAEDLARRPGE
LARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRP
SSGTLASASPDWAGPGARLRQPSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLT
MNAQLLEDEGLGPDPPHRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEE
TTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQ
KIIDAQEKRIASLDAANARLMSALTQLKESMH
Download sequence
Identical sequences M3Y7G1
ENSMPUP00000007268 ENSMPUP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]