SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007272 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007272
Domain Number 1 Region: 3992-4230
Classification Level Classification E-value
Superfamily Plakin repeat 3.58e-87
Family Plakin repeat 0.0000000273
Further Details:      
 
Domain Number 2 Region: 3413-3652
Classification Level Classification E-value
Superfamily Plakin repeat 3.79e-87
Family Plakin repeat 0.0000000398
Further Details:      
 
Domain Number 3 Region: 177-401
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-87
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 4 Region: 2754-2994
Classification Level Classification E-value
Superfamily Plakin repeat 9.81e-85
Family Plakin repeat 0.0000000923
Further Details:      
 
Domain Number 5 Region: 3082-3321
Classification Level Classification E-value
Superfamily Plakin repeat 1.16e-75
Family Plakin repeat 0.000000544
Further Details:      
 
Domain Number 6 Region: 3750-3987
Classification Level Classification E-value
Superfamily Plakin repeat 1.12e-74
Family Plakin repeat 0.00000089
Further Details:      
 
Domain Number 7 Region: 4303-4344,4379-4573
Classification Level Classification E-value
Superfamily Plakin repeat 1.74e-69
Family Plakin repeat 0.000000298
Further Details:      
 
Domain Number 8 Region: 418-533
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 1292-1476
Classification Level Classification E-value
Superfamily Spectrin repeat 1.25e-19
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 10 Region: 757-859
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 664-756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 12 Region: 4250-4296
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000471
Family Plakin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007272
Domain Number - Region: 1181-1291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000134
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 864-946
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000272
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007272   Gene: ENSMPUG00000007329   Transcript: ENSMPUT00000007391
Sequence length 4655
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897203.1:773486:806682:1 gene:ENSMPUG00000007329 transcript:ENSMPUT00000007391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLMPLDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGATNLQVMRAMASLRARGL
VRETFAWRHFYWYLTNEGMAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHAQSVQ
GPLGCPLKWGPQPAEDPAREERRVYRRKEPVEELAEPPVPPAAAPGNLGMSVLEPAPATD
ERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFH
KLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDM
TAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPTLIDMNKVFRQTNLEN
LDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVKASELQ
LRWQEYRELVLLLLQWVRHHTAAFEERRFPSSFEEIEILWCQFLKFKETELPAKEADKNR
SKGIFQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRGEFERLECLQRVV
SKLQMEAGLCEEQLNHADALLQSDVRLLAAGKAPQRAAEVERDLDKADGMIRLLFNDVQT
LKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKTGVAAPVTPVSVQTTQRRPELEDVT
LRYLQDLLAWVEENQRRVDSAEWGGDLPSVEAQLGSHRGLHQSVEEFRAKIERARADEGQ
LAPAPRGAYRDCLGRLDLQYAKLLNSSKARLRWLESLHGFVAAATKELMWLSEKEEEEVG
FDWGERNSNMAAKKESYSALMRELELREKKIKEIQSTGDRLLREGHPARPTVESFQAALQ
TQWSWMLQLCCCIETHLKENTAYFQFFSEVRETEEQLRKLQETLRRKYTCDRSVTVTRLE
DLLQDAQDEKDQLNEYRAHLSGLAKRAKAIVQLKPRNLAQPVRGRVPLLAACDYKQAEVT
VHKGDECQLLGAAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVT
LWHQLHVDMKSLLAWQSLSRDLQLIRSWSLVTFRTLKPEEQRQALRSLELHYQAFLRDSQ
DASSFGPEDRLQAERDYGSCSRHYQQLLQSAEQGAQEESRCQQCISELKDIRLQLEACET
RTVHRLRLPLDEEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAP
TLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLRAHEEQLKEAQAVPAT
LPELEATKAALKKLRGQAEAQQPVFDALREELRGAQAVGERLQRQHGERDVEVERWRERV
APLLERWQAVLSQTDVRLRELEQLGRQLRYYRESADPLDAWLRDAKRRQEQIQAVPLADS
QAVREQLRQEKALLEEIEQHGEKVEECQRLAKQYINAIKDYELQLVTYKAQLEPVASPAK
KPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERER
LAEVEAALEKQRQLAEAHAQAKAQAEREAQELQRRMQEEVARREEAAVDAQQQKRSIQEE
LQHLRETSEAEIQAKARQVEAAERSRLRIEEEIRVVRLQLETTERQRGGAEGELQALRAR
AEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRAVQALEEL
RLQAEEAERRLRQAEAERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERTLQEEHV
AVAQLREEAERHAQQQAEAERAREEAEQELERWRLKANEALRLRLQAEEVAQQKSLAQAE
AEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLVAEQELIRLRAE
TEQGEQQRQLLEEELARLQREAGAATQKRQELEAELAKVRAEMEVLLASKARAEEESRST
SEKSKQRLEAEAGRFRELAEEAARLRALAEETKRQRQLAEEDAARQRAEAERVLAEKLAA
ISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKA
SESELERQKGLVEDTVRQRRQVEEEILALKASFEKAAAGKVELELELGRIRSHAEDTLRS
KEQAELEAARQRQLAAEEEQRRREAEERVQKSLAAEEEAARQRKSALEEVERLKAKVEEA
RRLRERAEQESARQLQLAREAAQKRLQAEEKAHAFAVQQKEQELQQTLQHEQSELERLRE
EAERLKQSAEEQAQARARAQADAEKLRKDAEQEAARRAQAEQAALKQKQVADAEMEKHKQ
FAERTLRQKAQVEQELTALRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFS
VRVQMEELGKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAAR
LRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARQLQEDKEQ
MAQQLVQETQGFQRTLEAERQRQLEMSAEAERLKMRVAEMSRAQARAEEDAQRFRKQAEE
IGEKLHRTELATQEKVTLVHTLEIQRQQSDQDAQRLRAAIAELEREKEKLKEEAALLQHK
SEEMQVVQQEQLLQETRALQESFLSEKDRLLQRERFVEEEKAKLERLFQDEVAKAQKLRE
EQQRQRQQMEQEKQQLLASMEEARQRQREAEEGARRQQEELQRLQEQRRQQEELLAEENR
RLRERLQRLEEEHRAAQAQSEEIAAAQAVTAKALPNGRDAPDGPAAQAEPELAFDGLRRK
VPAQRLQEVGVLSSEELQRLAQGRTTVAELAQREDVRRYLQGRSGVAGLLLKPTDEKLSV
YAALQRQLLSPGTALILLEAQAASGFLLDPVHNRRLTVQEAVKEGVVGPELHHQLLSAER
AVTGYTDPYTGEQISLFQAMQKDLIVRDHGLRLLEAQIATGGIIDPVHSHRLPVDVAYRR
GYFDEDMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPDTGLRLLPLTDQAARGG
ELVYTDSEARDVFEKATVSAPFGRFQGRTVTIWELINSEYFTAEQRRDLLRQFRTGKVTV
EKIIKMVITVVEEHEQKGQLCFEGLRALVPAAELLESGVIDRDLLCQLQRGERSVREVAD
VDSVRRALRGANVIAGVWLEEAGQKVSIYEALKKDLLPPEAAVALLEAQAGTGHIIDPAT
SARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYKDPYSGQSVSLFQALKKGLIPREQGLR
LLDAQLATGGIVDPSKSHRVPVDVACARGYLDEETRRTLSAPGEEARTYRDPTSQEPVTY
GQLQQQCRPDQLTGLSLLPVSEKAAQARREGLCSELQAQETFQKTPVEVPVGSFKGRTVT
VWELLSSEYFTAEQRQELVRQFRTGTVTVEKVIKILITIVEEVETVRRERLSFSGLRAPV
PASELVASGVLSSTQFEQLKDGRTSVKDLSELNSVRTLLQGSGCLAGIYLESSKEKVTIY
EAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKA
VTGYKDPYSGNTISLFQAMKKGLVLRDHGIRLLEAQIATGGIIDPVHSHRLPVDVAYRRG
YFDEDMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLRGAEGTEVV
ETTQVYTEEETRRAFEETQIDIPGGGGRGSSTMSLWEVMQSDLIPEEQRTRLLADFQAGR
VTKERMIVIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLHEARIISHEIYGLLRAGTKS
LRQVLEEESASRYLYGTGCVAGIYLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAATGF
LLEPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIP
AEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNRDTYEQLSEPSEVRSYLDPSTD
ERLSYTQLLRRCCRHETSGQLLLPLSDACKLTFRGLRKQITVEELVRSQVMDEATALRLQ
EGLASVEEVSRNLQKFLEGTSCIAGVLVDATKERLSVYQAMKKGVIRPGTAFELLEAQAA
TGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKG
LILKDHGIRLLEAQIATGGIIDPEESHRLPVDVAYQRGLFDEEMNEILTDPSDDTKGFFD
PNTEENLTYLQLMERCVEDPGTGLRLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEM
SVYEAYRKGLIDHQTYLELSEQECEWEEVTISSSDGAVKSMLTDRRSGRQYDIDEAIARN
LIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAPSRTQVTSWAD
PTEETGPVAGILDTETLEKVSITEAMHRGLVDNITGQRLLEAQACTGGILDPSSGERFPV
TDAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQY
LTGGLIEPDAPGRVPLDEALQRGMVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDR
SMVEEGTGLRLLEAAAQSTKGYYSPYSISGSGSTAGSRSGSRTGSRAGSRRGSFDATGSG
FSMTFSSSSYSSSGYGRRYASGPAPSLGGPESAAA
Download sequence
Identical sequences M3Y7G5
ENSMPUP00000007272 ENSMPUP00000007272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]