SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007299 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007299
Domain Number 1 Region: 40-179
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.15e-43
Family Gelsolin-like 0.000000305
Further Details:      
 
Domain Number 2 Region: 407-551
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.19e-37
Family Gelsolin-like 0.000000229
Further Details:      
 
Domain Number 3 Region: 160-264
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.55e-29
Family Gelsolin-like 0.00000293
Further Details:      
 
Domain Number 4 Region: 277-389
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.32e-29
Family Gelsolin-like 0.00000103
Further Details:      
 
Domain Number 5 Region: 537-636
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.94e-19
Family Gelsolin-like 0.00000504
Further Details:      
 
Domain Number 6 Region: 620-690
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000467
Family Gelsolin-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007299   Gene: ENSMPUG00000007357   Transcript: ENSMPUT00000007419
Sequence length 717
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897115.1:829413:1081857:-1 gene:ENSMPUG00000007357 transcript:ENSMPUT00000007419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGADNRLSCASAVVPAPPHGAALFPSQPCKPSSMVVEHPEFLKAGKEPGLQIWRVEKFD
LVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDD
YLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV
VRATEVPVSWESFNNGDCFILDLGNDIYQWCGSNSNRFERLKATQVSKGIRDNERSGRAR
VHVSEEGAEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVAD
ENPFAQGALRSEDCFILDHGRDGKIFVWKGRQANTEERKAALKTASDFISKMDYPRQTQV
SVLPEGGETPLFKQFFKNWRDPDQTDGPGLAYLSSHIANVERVPFDAATLHTSTAMAAQH
GMDDDGTGQKQIWRIEGSNKVPVDPSTYGQFYGGDSYIILYNYRHGNRQGQIIYNWQGAQ
STQDEVAASAILTAQLDEELGGSPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQ
TAPASTRLFQVRASSSGATRAVEIIPKAGALNSNDAFVLKTPSAAYLWVGAGASEAEKTG
AQELLRVLRAQPVQVAEGSEPDSFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIG
RFVIEEVPGELMQEDLATDDVMLLDTWDQVLVYPLPCQNLTFFITKSPAWPHTRQRR
Download sequence
Identical sequences M3Y7J2
ENSMPUP00000007299 ENSMPUP00000007299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]