SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007303 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007303
Domain Number 1 Region: 379-582
Classification Level Classification E-value
Superfamily vWA-like 2.67e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 2 Region: 237-335
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.02e-21
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 3 Region: 29-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.51e-18
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007303   Gene: ENSMPUG00000007361   Transcript: ENSMPUT00000007423
Sequence length 651
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:411696:426337:-1 gene:ENSMPUG00000007361 transcript:ENSMPUT00000007423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPRRPLRARAPPGPRPSPALAPLPELRLSCRHLLDRDPLTKSDPSVVLLLQSQSQWVQV
DRTEVVRSSLHPVFSKVFTLDYYFEEVQKLRFEVYDTHGPCSLGCQDDDFLGGMECTLGQ
SWVQSSRWLPTSVGTCVPDHLPAPTGDVLTPPPPSSLANSSWEKIVHTPDTGVDTRVLPC
VHRHTCTHGHSSDFQIVAQKKMTRALLLKFGRNAGKSTITVIAEDISGNNGYVELSFRAR
KLDDKDLFSKSDPFLELYRVNDDQSEQLVYRTEVVKNDLSPVWEPFKVSLCNLCCCEETR
PLKCLVWDHDSRGKHDFIGEFSTTFEEMQKAFREHQAQWDCVNAKYKQKKRHYKNSGVVI
LADLKFYRVHSFLDYIMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPFQPNEYLQALLA
VGEICQDYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPR
VQLYGPTNVAPIISKVARMAAAEERSGEASQYYILLVLTDGVVTDMADTREAIVRASHLP
MSIIIVGVGNADFTDMQTLDGDDGVLRSPRGEPALRDIVQFVPFRELKSASPAALAKCVL
AEVPRQLVEYYSYRELPPRGGGAHDREAGPPETAGPPGVQPRSVASTLEVP
Download sequence
Identical sequences M3Y7J6
ENSMPUP00000007303 ENSMPUP00000007303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]