SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007307 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007307
Domain Number 1 Region: 121-253
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-38
Family Third domain of FERM 0.00052
Further Details:      
 
Domain Number 2 Region: 19-123
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-33
Family Second domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007307   Gene: ENSMPUG00000007365   Transcript: ENSMPUT00000007427
Sequence length 747
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:13835951:13962733:-1 gene:ENSMPUG00000007365 transcript:ENSMPUT00000007427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIGPSYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCL
QAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWL
EMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVE
DDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHSFFRLRTPGNSKSNRSDFIRLGSRFRF
SGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKATNPVIAAQFCSKTNPEVHNYQP
QYHPTIHPSQPRWHPHSPNVSYPLPSPGLSSSDRLPFGVEENGGPSRASARHHHHHHQHQ
HQHHPNYGLSLTLENKEGPSRSPNSSSKSLTKLSPGPPALFSEAAAHLKKLELETVKAPG
PWPALHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVSAQVGKEEST
FVNINKKSSLQDANVRSPIPIRVETTQPVLEKPEIKPPRVRKLTRQYSFDEDDLPPDLAE
AVGAPTATATNTTAATTQVSVPLVSPKGHKLSSPQNSESKGQLSPGAKSPSDRGGAFTLE
PGDLLMDFTEATPLAEPASAPHCAHSRCSPPLSPPMKEETTGVCMHPPIKTRLIKTFPAD
PVTPFPDVFNSGPQFTADFRDSKLPCCPGQSSPLIPAVTLRPLTETISTVQTIYTTRKPV
SLAASAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences M3Y7K0
ENSMPUP00000007307 ENSMPUP00000007307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]