SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007349 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007349
Domain Number 1 Region: 186-377
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.91e-87
Family p53 DNA-binding domain-like 0.000000552
Further Details:      
 
Domain Number 2 Region: 559-625
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.71e-23
Family SAM (sterile alpha motif) domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 417-457
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000589
Family p53 tetramerization domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007349   Gene: ENSMPUG00000007407   Transcript: ENSMPUT00000007469
Sequence length 710
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:4716656:4739034:-1 gene:ENSMPUG00000007407 transcript:ENSMPUT00000007469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSRACLSFLRNRGPLPCWPGLSSCWRRSRDSSGAVGLSSPSPWVATGKPLTAHSVGPW
LVLEERGHGDSGLGSRLAPRLPQPRTHGALSPAEQEAGPRPVLPAVRSARLSSFVPSTPG
QCRSRRRSLEPRKSQFNLLSSTMDQMSGRAASASPYTPEHAASVPTHSPYAQPSSTFDTM
SPAPAIPSNTDYPGPHHFDVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSSPP
PPGTIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNEGQSAPASHLIRVEGNSLSQYVDDP
VTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRS
FEGRICACPGRDRKADEDHFREQQALSESAAKNGAAGKRAFKQSPPAVPALGPNVKKRRQ
GDEDVYYMHVRGRENFEILMKVKESLELMELVPQQLVDAYRQQQQQLLQRPSHLQPAPYG
PVLSPMSKAHGGVNKLPSVNQLVGQPPPHGSAAGPNLGPMGPGILTNHGHTLPAGGEMNG
SHSAQSMVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSVYHLQNLTVEDL
GALKIPDQYRMTIWRGLQDLKQSHDCGAQQLIRSSSNASTISIGSSGELQRQRVMEAVHF
RVRHTITIPNRGGPGGGAGPDEWADFGFDLPDCKSRKQSIKEEFTESEIH
Download sequence
Identical sequences M3Y7P2
ENSMPUP00000007349 ENSMPUP00000007349 XP_004768771.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]